Conserved Protein Domain Family
PHA_granule_1

?
TIGR01837: PHA_granule_1 
poly(hydroxyalkanoate) granule-associated protein
This model describes a domain found in some proteins associated with polyhydroxyalkanoate (PHA) granules in a subset of species that have PHA inclusion granules. Included are two tandem proteins of Pseudomonas oleovorans, PhaI and PhaF, and their homologs in related species. PhaF proteins have a low-complexity C-terminal region with repeats similar to AAAKP. [Fatty acid and phospholipid metabolism, Biosynthesis]
Statistics
?
PSSM-Id: 130896
View PSSM: TIGR01837
Aligned: 5 rows
Threshold Bit Score: 126.794
Threshold Setting Gi: 22971625
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAA09108      18 EVRGYARKIWLAGIGAYARVGQEGSDYFNELVKAGEGVEKRGKKRIDKELDAANnqiDEATQEVSRVRGKVEVQLDKIEK 97  Pseudomonas ole...
BAB91367      17 KVEDYSRKIWLAGLGVYSKIDTDGSKLFDTLVKDGEKAEKLTKSAVGKKVDAAKdsaQSAKSRVGDVKDRALGKWGELEE 96  Pseudomonas sp....
ZP_00018566   26 QVFEVVRKLMLAGIGAFALSREEAEAFLNRLVERGELAQKDAQKLFDEAMERFR------KTALPQT-DQVQTNLNNLTA 98  Chloroflexus au...
WP_004090544  31 RLGKSAERVWLAGIGALGRVQSEGARFFEALVNEGEEIKQRRRESSLHSAESIR---EHVEVKLEETWENTQRNWRRMNQ 107 Xylella fastidiosa
WP_003485818  28 RLGESAQTVWLAGLGALGRVQNEGSKLFDSLVREGAAYERTGQRRAAESVDELR---EEVETQFEQARDTAVRGWDKLGK 104 Xanthomonas
CAA09108      98 AFDARVGRALNRLGIPSKHDVEALSIKLEQLHELLERVAHK 138 Pseudomonas oleovorans
BAB91367      97 AFDKRLNSAISRLGVPSRNEVKALHSKVDTLTKQIERLTGA 137 Pseudomonas sp. 61-3
ZP_00018566   99 QVETSFEQFLNRLNIPSKRDIDELSAKIAQLAVRVEELRRA 139 Chloroflexus aurantiacus
WP_004090544 108 LFDERIQDILHTLKIPTREEIEALRHEIEILRNELHELRNE 148 Xylella fastidiosa
WP_003485818 105 AFDERVKGVLRTLNIPEQEELENLRREVESLKAQVRANTAA 145 Xanthomonas
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap