Conserved Protein Domain Family
PHA_synth_III_C

?
TIGR01836: PHA_synth_III_C 
poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit
This model represents the PhaC subunit of a heterodimeric form of polyhydroxyalkanoic acid (PHA) synthase. Excepting the PhaC of Bacillus megaterium (which needs PhaR), all members require PhaE (TIGR01834) for activity and are designated class III. This enzyme builds ester polymers for carbon and energy storage that accumulate in inclusions, and both this enzyme and the depolymerase associate with the inclusions. Class III enzymes polymerize short-chain-length hydroxyalkanoates. [Fatty acid and phospholipid metabolism, Biosynthesis]
Statistics
?
PSSM-Id: 130895
View PSSM: TIGR01836
Aligned: 6 rows
Threshold Bit Score: 550.879
Threshold Setting Gi: 22797878
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P45366         4 IDIRPDKLAQEMLDYTS------KLGQGMENLL--NADaIDTGVSPKEAVYSEDKLVLYRYDTPAGVtpQKTPLLIVYAL 75  Thiocystis viol...
CAD42686       6 NNSLINYLVNDYFTFVRdpdnisKLKEIRKKLS--NIEnIKTGSSEYEVIRETTLFRLLHYKPLKQQt-FKYPLLIVYAL 82  uncultured cren...
AAD05260       9 WEKLIKSMPSEYKSSAR------RFKRAYEIMT--TEAePEVGLTPKEVIWKKNKAKLYRYTPVKDNl-HKTPILLVYAL 79  Bacillus megate...
WP_011712836   4 LQLTPQSIAQELADFNK------NLAEGYKNLA--ELGpIEVGTSDKEVVYREDKMVLYRFTPQVKKp-HAVPMLIVYAL 74  Magnetococcus m...
WP_011037305   5 LGFSAEDLMQETLSMQR------KLREGLKLLP--GVEdVDYGVTERQEVWRDGKVVLYRFVGDAAPv-ARTPLLIVYAL 75  Xanthomonas cam...
WP_010872060  19 AQVGLEENLHETLDFTE------KFLSGLENLQglNEDdIQVGFTPKEAVYQEDKVILYRFQPVVENp-LPIPVLIVYAL 91  Synechocystis s...
P45366        76 VNRPYMTDIQEDRSTIKGLLATGQDVYLIDWGYPDQADSALTLDDYINGYIDSCVDYLCETHEVDQVNILGICQGGAFSL 155 Thiocystis viol...
CAD42686      83 INKSYILDLQNDKSWIRNLLEQGINVYLIDWKPPSKLDKYITVDDYVNLFIYECVEYIKNIENIDQISLQGYCMGGTMSL 162 uncultured cren...
AAD05260      80 INKPYILDLTPGNSLVEYLLNRGFDVYLLDWGTPGLEDSNMKLDDYIVDYIPKAAKKVLRTSKSPDLSVLGYCMGGTMTS 159 Bacillus megate...
WP_011712836  75 VNRPYMTDLQEDRSTIRGLLEEGMDVYLIDWGYPDAADRYLGLEDYVDGYIKRSVNHICRSHDLDAINLLGICQGGAFSL 154 Magnetococcus m...
WP_011037305  76 VNRPYMVDLQADRSLVKGLLGHGQDVYVLDWGYPDRSERYLTLEDYLLRYIDGAVDHLRAASGLEAVDVLGICQGGTFAL 155 Xanthomonas cam...
WP_010872060  92 VNRPYMVDLQEGRSLVANLLKLGLDVYLIDWGYPSRGDRWLTLEDYLSGYLNNCVDIICQRSQQEKITLLGVCQGGTFSL 171 Synechocystis s...
P45366       156 MYASLHPDK-VKNLVTMVTPVDFKTPGNLLSAW------VQNVDIDLAVDTMGNIPGELLNWTFLSLKPFSLTGQKYVNM 228 Thiocystis viol...
CAD42686     163 MYTSLYQKN-IKNLVTIAPIVDAEKDKSVIKNM------AEHMDIDKVLSYHENFPYELLYLVYASLKPFKQGVNKYYNL 235 uncultured cren...
AAD05260     160 IFAALNEDLpIKNLIFMTSPFDFSDTGLYGAFLd-----DRYFNLDKAVDTFGNIPPEMIDFGNKMLKPITNFYGPYVTL 234 Bacillus megate...
WP_011712836 155 CFAALYPEK-VKNLVTMVTPVDFQTPDNMLSLW------ARHLDVDLLVETMGNVPGELLNFTFLSMKPFSLTGQKYLDL 227 Magnetococcus m...
WP_011037305 156 CYAALERAK-IRNLITMVTPVDFHTPDNMLSNW------ARMVDVDLFVDTMGNVPADLMNASYLMLKPFRLNLQKYVGL 228 Xanthomonas cam...
WP_010872060 172 CYASLFPDK-VKNLVVMVAPVDFEQPGTLLNARggctlgAEAVDIDLMVDAMGNIPGDYLNLEFLMLKPLQLGYQKYLDV 250 Synechocystis s...
P45366       229 VDMLDDPDKVKNFLRMEKWIFDSPDQAGETFRQFTKDFYQKNGFINGGVKLGGKEIDLKNVDCPVLNIYALQDHLVPPDA 308 Thiocystis viol...
CAD42686     236 FKNFEDESFVQNFLRIEKWLYDTPPIAGETFRQWVKDIYQQNLFAKNKMIVGENKINLSNIKVPVLNVVAEFDHLVTSDS 315 uncultured cren...
AAD05260     235 VDRSENQRFVESWKLMQKWVADGIPFAGEAYRQWIRDFYQQNKLINGELEVRGRKVDLKNIKANILNIAASRDHIAMPHQ 314 Bacillus megate...
WP_011712836 228 VEIMQDKTKLCNFMRMEKWIFDSPDQAGEAFRQFIKMFYQENGLVNGTAQIGGKEVKLENITMPILNIYATLDHLVPPAA 307 Magnetococcus m...
WP_011037305 229 LDILDDKQALEDFLRMEKWIFDSPDLAGEAFREFVTQFYQRNGLVTGDVRIGGQAVDLHAVDMPVLNIYAEHDHLVPPDA 308 Xanthomonas cam...
WP_010872060 251 PDIMGDEAKLLNFLRMEKWIFDSPDQAGETYRQFLKDFYQQNKLIKGEVMIGDRLVDLHNLTMPILNLYAEKDHLVAPAS 330 Synechocystis s...
P45366       309 SKALNPWSAA-RTYTELAFPGGHIGIYVSGKAQKEVTPAIGKWLNER 354 Thiocystis violacea
CAD42686     316 SSSLNNLISS-QDKSLMKFPTGHVGLIASNFSQKNVLPKIGKWIQTH 361 uncultured crenarchaeote
AAD05260     315 VAALMDAVSS-EDKEYKLLQTGHVSVVFGPKAVKETYPSIGDWLEKR 360 Bacillus megaterium
WP_011712836 308 SKVLKGLVGS-TDYTELPFKGGHIGIYVSGRAQREVPPSIANWLKAR 353 Magnetococcus marinus
WP_011037305 309 SRALRGLVGS-EDYTELSFRGGHIGIYVSGRAQREVPVAIHRWLQAR 354 Xanthomonas campestris
WP_010872060 331 SLALGDYLPEnCDYTVQSFPVGHIGMYVSGKVQRDLPPAIAHWLSER 377 Synechocystis sp. PCC 6803
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap