Conserved Protein Domain Family
gatC_rel

?
TIGR01827: gatC_rel 
Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase, subunit C, putative
This model represents a family small family related to GatC, the third subunit of an enzyme for completing the charging of tRNA(Gln) by amidating the Glu-tRNA(Gln). The few known archaea that contain a member of this family appear to produce Asn-tRNA(Asn) by an analogous amidotransferase reaction. This protein is proposed to substitute for GatC in the charging of both tRNAs.
Statistics
?
PSSM-Id: 130886
View PSSM: TIGR01827
Aligned: 3 rows
Threshold Bit Score: 78.0615
Threshold Setting Gi: 499178514
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q57694        8 KIKKEAEEIINKFSEVLEKFNlEMEESYYIIDTRNVLREDEAVESNPEFREKFLKIAPkVNKEGYVVVEKGSWLK 82  Methanocaldococcus ja...
AAM01574     12 DILRETMELLEEFAERLEDVD-AEDETWTTSEGSRKFREDDEPRCDREFKKKMLENAP-RSDDGYVIAERAHWLR 84  Methanopyrus kandleri...
WP_010876054  2 KIEKEAEKILEEFSRALEEVP-ELEETYYIVDNLNRTREDEEEKTEP---GKILRNAP-VDDDGNIVVERGEWTQ 71  Methanothermobacter t...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap