Conserved Protein Domain Family
gly_Cac_T_rel

?
TIGR01825: gly_Cac_T_rel 
pyridoxal phosphate-dependent acyltransferase, putative
This model represents an enzyme subfamily related to three known enzymes; it appears closest to glycine C-acteyltransferase, shows no overlap with it in species distribution, and may share that function. The three closely related enzymes are glycine C-acetyltransferase (2-amino-3-ketobutyrate coenzyme A ligase), 5-aminolevulinic acid synthase, and 8-amino-7-oxononanoate synthase. All transfer the R-group (acetyl, succinyl, or 6-carboxyhexanoyl) from coenzyme A to an amino acid (Gly, Gly, Ala, respectively), with release of CO2 for the latter two reactions.
Statistics
?
PSSM-Id: 130884
View PSSM: TIGR01825
Aligned: 4 rows
Threshold Bit Score: 671.146
Threshold Setting Gi: 380742510
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O31777         8 LKAELNSMKENHTWQDIKQLESMQGPSVTVNHQKVIQLSSNNYLGFTSHPRLINAAQEAVQQYGAGTGSVRTIAGTFTMH 87  Bacillus subtil...
WP_000250824   9 LEENINYLKENGLYNEIDTIEGANGPEIKINGKSYINLSSNNYLGLATNEDLKSAAKAAIDTHGVGAGAVRTINGTLDLH 88  Staphylococcus ...
WP_010888972  38 LRQDLAGLRESGLLISPRVLDAPQRARTRVDGREVVNLASNNYLGFADHPRLKERAAQYLQQWGVGAGAVRTIAGTLRIH 117 Deinococcus rad...
CCE71144       7 ikeeleelkkkGLYVTIRVLQSAQGPWVVVNGKRVLNMCSNNYLGLAAHPKIKEAAIRAILDYGVGAGAVRTIAGTMELH 86  Pyrococcus abys...
O31777        88 QELEKKLAAFKKTEAALVFQSGFTTNQGVLSSILSKED--IVISDELNHASIIDGIRLTKADKKVYQHVNMSDLERVLRK 165 Bacillus subtil...
WP_000250824  89 DELEETLAKFKGTEAAIAYQSGFNCNMAAISAVMNKND--AILSDELNHASIIDGCRLSKAKIIRVNHSDMDDLRAKAKE 166 Staphylococcus ...
WP_010888972 118 EDFERQLADFKHTGSALVLHSGFSTNQGVLGGLLREGD--LVVSDELNHASIIDGLRLTKATKKIYKHADPADLDRVLRE 195 Deinococcus rad...
CCE71144      87 VELEEKLAKFKKREAAILFQSGYNANLGAISALLRKGEdgIFLSEELNHASIIDGMRLSGAPKVIYKHLDMDDLKKKLEE 166 Pyrococcus abys...
O31777       166 SMN---YRMRLIVTDGVFSMDGNIAPLPDIVELAEKYDAFVMVDDAHASGVLGeNGRGTVNHFGLD-GRVHIQVGTLSKA 241 Bacillus subtil...
WP_000250824 167 AVEsgqYNKVMYITDGVFSMDGDVAKLPEIVEIAEEFGLLTYVDDAHGSGVMG-KGAGTVKHFGLQ-DKIDFQIGTLSKA 244 Staphylococcus ...
WP_010888972 196 NPS---EGLKLVVTDGVFSMDGDVAPLDKLVEVARRYGAVTYVDDAHGSGVMGeAGRGTVHHFGFEyADDVIQVGTLSKA 272 Deinococcus rad...
CCE71144     167 NKD---KKKKIIVTDGVFSMDGDLAPLPEIVELAEQYDAIVYVDDAHGEGVLGsHGRGIVDHFNLH-DKVDFEMGTLSKA 242 Pyrococcus abys...
O31777       242 IGVLGGYAAGSKVLIDYLRHKGRPFLFSTSHPPAVTAACMEAIDVLLEEPEHMERLWENTAYFKAMLVKMGLTLTKSETP 321 Bacillus subtil...
WP_000250824 245 IGVVGGYVAGTKELIDWLKAQSRPFLFSTSLAPGDTKAITEAVKKLMDSTELHDKLWNNAQYLKNGLSKLGYDTGESETP 324 Staphylococcus ...
WP_010888972 273 WGGVGGYAAGHPDLRELLINRARPYLFSTAQPPAVVGALAAALDEVQRDPSLMERLWDNTRFFKAELGRLGFDTLGSVTP 352 Deinococcus rad...
CCE71144     243 FGVIGGYVAGPEEAIEYLKQRARPFLFSSAMNPPDVAAAIAAVEILQKSDDLVKKLWDNTHFLQKGLRDLGYDLGNTKHP 322 Pyrococcus abys...
O31777       322 ILPILIGDEGVAKQFSDQLLSR-GVFAQSIVFPTVAKGKARIRTIITAEHTKDELDQALDVIEKTAKELQLL 392 Bacillus subtilis subsp...
WP_000250824 325 ITPVIIGDEKTTQEFSKRLKDE-GVYVKSIVFPTVPRGTGRVRNMPTAAHTKDMLDEAIAAYEKVGKEMKLI 395 Staphylococcus aureus
WP_010888972 353 ITPVVFGEASAAFEASRRLFDL-GIFAVGLGFPTVPRDLARIRNIVTAEHTRDDLEQALSAYQQVGRDLGVI 423 Deinococcus radiodurans
CCE71144     323 ITPVMLYDEKLAQEFSRRLYEEyNIFAQAIVYPTVPLGTARIRLEPSAAHTKEDLKLVIDAFEDLGKKTGFL 394 Pyrococcus abyssi GE5
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap