Conserved Protein Domain Family
PabB-clade2

?
TIGR01824: PabB-clade2 
aminodeoxychorismate synthase, component I, clade 2
This clade of sequences is more closely related to TrpE (anthranilate synthase, TIGR00564/TIGR01820/TIGR00565) than to the better characterized group of PabB enzymes (TIGR00553/TIGR01823). This clade includes one characterized enzyme from Lactococcus and the conserved function across the clade is supported by these pieces of evidence: 1) all genomes with a member in this clade also have a separate TrpE gene, 2) none of these genomes contain an aparrent PabB from any of the other PabB clades, 3) none of these sequences are found in a region of the genome in association with other Trp biosynthesis genes, 4) all of these genomes aparrently contain most if not all of the steps of the folate biosynthetic pathway (for which PABA is a precursor). Many of the sequences hit by this model are annotated as TrpE enzymes, however, we believe that all members of this clade are, in fact, PabB. The sequences from Bacillus halodurans and subtilus which score below the trusted cutoff for this model are also likely to be PabB enzymes, but are too closely related to TrpE to be separated at this time.
Statistics
?
PSSM-Id: 130883
View PSSM: TIGR01824
Aligned: 7 rows
Threshold Bit Score: 403.384
Threshold Setting Gi: 499338133
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P74130       131 GGWLGWLGYDTAWAIEKLPYSKADDLPFPVAYWYEPENFVILDH-Q-------EQLLWLATTDQEKIKFFQT-----QLA 197 Synechocystis s...
P27629       100 GGALGYFAYDVGRRLEGYNDLGIEDWAIPDLAGSSYEIGVSADH-Qn------DVIVLIAHASADGNDVFITssrqlSMV 172 Lactococcus lac...
WP_011712123  22 AQRQAEQAEQVAPLLR--WADVQAHQGHWVAGYVRYEAACAWDL-P----------VHPTTQPLAWFGCYAP-----PQP 83  Magnetococcus m...
WP_005920500  96 GGWAVLLDYELAAQVEPILQLPTRRDGVPTALALRAPAAVLRDRlH-------GRCVALAE-PGREE-LLQQigddlAAC 166 Xanthomonas
WP_010902237 104 GGLFGWLSYDIARELEAIPDTTTDARGLPRLQLGVYPTIAAWRE-PftpgddlRLIAAVPVDEYTPDGAFEAgrdrvQSL 182 Halobacterium s...
WP_010920790 164 GGVVGLGAYELGDRVE---DLGLSRTDWPDLTCARYPALLAFDH-Ha------RQVIAVGRGEAEAEAN-ARaadalAWL 232 Caulobacter vib...
WP_011027841  11 GDRLATGLLDVTSD----PAALESEGFWAVCADFEGGLTCARFA-E----------VRTEPVPAPTPGEWRG-----PAV 70  Streptomyces co...
P74130       198 DKINSVSSPQVPPLN--LTYT----TDQDQYETMVNQAKQYIKAGDIFQANLTLRFIAKt--eQKLnsWQVYQHLQTINP 269 Synechocystis s...
P27629       173 AGPTCCASGDVEILRnkLHYYg--vIPFSQDDCGFNRLKDYLGSGDMYQVNLGNRNVGAi--vMTL--FQGYNQLRLMNP 246 Lactococcus lac...
WP_011712123  84 ACYPHLPT----PPPvtLELL----IQQARYDQDLKRILDFIHAGDTYQVN----HTVRalphFEGtlLDLFLDRQARYR 151 Magnetococcus m...
WP_005920500 167 AALPPLPAW-AGPLAvdEEA-------PERFTGAVERVLDYLRAGDVFQANISRAWHAAf--aAVVdpAALHARLRAANP 236 Xanthomonas
WP_010902237 183 AAAIRDGDPAVGPPPadSPAPfesvAGRAAFESRVRRIQDAIRDGDTFQANVSHRLDAP----AAVhpVAVFEALRDTNP 258 Halobacterium s...
WP_010920790 233 EVAAPERAEPAGPLCadLVAS-----DPATYETAVAQVVARIVGGEIFQANIARAWTGRl--aAGVdpFDLFVRLRAQSP 305 Caulobacter vib...
WP_011027841  71 GDWTS---------------S----LDRAAYTTGVRRIRAHIAAGEVYQANLCRVLTAPigpgADVdaLTALLARGNPAP 131 Streptomyces co...
P74130       270 SPFASYWRSPWgdVVSCSPERLVKLEGN-VAQTRPIAGTRARGKNLAEDEQLLQELLVNTKELAEHIMLVDLERNDLGRV 348 Synechocystis s...
P27629       247 GPYMVFLDEAN--IIMASPEIVLADEAN-DLNTRPIAGTLMRLNEQDEDGVNAACLGQHHKDRAEHMMIVDLVRNDLGRV 323 Lactococcus lac...
WP_011712123 152 FPYAIWLESPGtsVASLSPELFLHRQGS-LVTTAPIKGTRPRGETLAEDQQLAMALSQASKDAAEHIMIVDMARNDLGRV 230 Magnetococcus m...
WP_005920500 237 APFAGLFVAAGraVASSSPERLVSVQGD-VVQTRPIAGTRARFAG-DDDAARIRELVGHPKERAEHVMLIDLERNDLGRI 314 Xanthomonas
WP_010902237 259 APYSGIVEFPGvdLVSASPELLLARRGR-ELTTEPIAGTRPRGATPAEDDAARAALRADDKERAEHAMLVDLERNDLGKV 337 Halobacterium s...
WP_010920790 306 APFSAYWRLPGraLVSNSPERFLKLDAAgAIQTQPIKGTRPRGRDPVEDRALAAELLASDKDRAENLMIVDLMRNDLARV 385 Caulobacter vib...
WP_011027841 132 YAGTIRLPEHGveIATASPELFLRRDGR-TVESGPIKGTGRTEADLLE------------KDYAENVMIVDLVRNDLGRV 198 Streptomyces co...
P74130       349 CTWGTVEVDELLAIERYSHVSHLVSNVKGILQPDKTGVDLVKALFPGGTITGCPKIRCLEIIEELEPVRRSLFYGSCGYW 428 Synechocystis s...
P27629       324 GRFGSVNVQEIVGAENYSVVMHIVSRVTGSLNEAFEAMEIIRAGFPGGSITGAPKVRAMEIIEELEPQRRDGWGGSIGYI 403 Lactococcus lac...
WP_011712123 231 CETGTIRVPHLKNRRSFATVHHLESRVEGRLREGLDLAHLFEALFPAASITGAPKKRTMEIIKSLEPQPRSLYTGCVGVI 310 Magnetococcus m...
WP_005920500 315 CAPGTVEVDELMCVESYAHVHHIVSNVRGRLRAGVTPGEVIAAVFPGGTITGCPKVRCMQVIAELEQTARGAYTGAFGWL 394 Xanthomonas
WP_010902237 338 SEYGSVAVPDYRRVDAYSEVLHLVSEVTGRLRDSCSLRDAIAAVFPGGTITGAPKPRTMALIDTVEATRRGPYTGSLAAI 417 Halobacterium s...
WP_010920790 386 SPAGSVRAPELFKVESFANVHHLVSTVTARLAPGRGVADLLRASFPPGSITGAPKVQAMKVIAELEP-PRGPYCGSLFWA 464 Caulobacter vib...
WP_011027841 199 CATGTVTVPDLCAVEKHPGLVHLVSTVRGELPADAGWPDLLDAAFPPGSVTGAPKSSALRIIDALETAPRGPYCGGVGWV 278 Streptomyces co...
P74130       429 DQR-GNLDLNILIRTL-----L-FTSGQVTGQVGAGIVADSDPAKEWLESLQKAKAL 478 Synechocystis sp. PCC 6803 substr. Kazusa
P27629       404 AYR-GNIGYRIAIRTL-----F-ACNGQLFASSGAGLVGDSMEDGEYNETFEKMRAL 453 Lactococcus lactis subsp. lactis
WP_011712123 311 RPG-GEALFNVAIRTL-----EqQGHTPPLLGLGGGIVADSQPLDEWQELAHKGGFL 361 Magnetococcus marinus
WP_005920500 395 NRD-GDMDLNILIRTA-----E-VAGHHVHFRTGAGIVVDSDPQRELDETRAKARGV 444 Xanthomonas
WP_010902237 418 GFD-GDATLSITIRTL-----V-RRAATYHLRVGAGIVHDSTPAAEYDETLAKARAL 467 Halobacterium salinarum
WP_010920790 465 GVD-GAFDSSVLIRTVgl-vqD-GAGWRLEARAGAGIVADSDPRGERLETEAKIAAL 518 Caulobacter vibrioides
WP_011027841 279 DADrGTGGLAVGIRTFwleraA-GGEARLRFGTGAGITWGSDPEGEWRETELKAARL 334 Streptomyces coelicolor
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap