1FC4


Conserved Protein Domain Family
2am3keto_CoA

?
TIGR01822: 2am3keto_CoA 
Click on image for an interactive view with Cn3D
glycine C-acetyltransferase
This model represents a narrowly defined clade of animal and bacterial (almost exclusively Proteobacterial) 2-amino-3-ketobutyrate--CoA ligase, now called glycine C-acetyltransferase. This enzyme can act in threonine catabolism. The closest homolog from Bacillus subtilis, and sequences like it, may be functionally equivalent but were not included in the model because of difficulty in finding reports of function. [Energy metabolism, Amino acids and amines]
Statistics
?
PSSM-Id: 130881
View PSSM: TIGR01822
Aligned: 6 rows
Threshold Bit Score: 715.044
Threshold Setting Gi: 14278152
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1FC4_A         8 FYQQLTNDLETARAEGLFKEERIITSAQQADITVaDG--SHVINFCANNYLGLANHPDLIAAAKAGXDSHGFGXASVRFI 85  Escherichia coli
O75600        27 LRGILEGELEGIRGAGTWKSERVITSRQGPHIRV-DGvsGGILNFCANNYLGLSSHPEVIQAGLQALEEFGAGLSSVRFI 105 human
WP_011036153   8 LTAHYAAELESIQSQGLFKSERIITGPQSAQITLaDG--RSVLNFCANNYLGLADHPDIIQAAKDALDTHGFGMASVRFI 85  Xanthomonas cam...
WP_004585010   5 MKDYLAAELKSIEEAGLYKKERIIITPQRADIRVnEG--QEVLNFCANNYLGLSDHPRLIQAAKDAMDERGFGMSSVRFI 82  Porphyromonas g...
WP_011004253   7 FYAFIRTELDAIREAGLFKQERVIASPQGARVRTiDG--REVINLCANNYLGLSSHPRVIDAAHEALRTHGFGLSSVRFI 84  Ralstonia solan...
P07912         5 FYQQLTNDLETARAEGLFKEERIITSAQQADITVaDG--SHVINFCANNYLGLANHPDLIAAAKAGMDSHGFGMASVRFI 82  Escherichia coli
1FC4_A        86 CGTQDSHKELEQKLAAFLGXEDAILYSSCFDANGGLFETLLGAEDAIISDALNHASIIDGVRLCKAKRYRYANNDXQELE 165 Escherichia coli
O75600       106 CGTQSIHKNLEAKIARFHQREDAILYPSCYDANAGLFEALLTPEDAVLSDELNHASIIDGIRLCKAHKYRYRHLDMADLE 185 human
WP_011036153  86 CGTQDLHKQLERTIADFFGTEDTILYAACFDANGGLFEPLLGEHDAIISDALNHASIIDGVRLCKAKRFRYANCDMADLE 165 Xanthomonas cam...
WP_004585010  83 CGTQDIHKELEKAIAEYFHTEDTILYAACFDANGGVFEPLFGEEDAIISDALNHASIIDGVRLCKAKRYRYENANMEDLE 162 Porphyromonas g...
WP_011004253  85 CGTQDLHKTLEARLSAFLGTEDTILYGSAFDANGGLFETLLGAEDAVISDALNHASIIDGIRLCKARRYRYQHNDLDDLR 164 Ralstonia solan...
P07912        83 CGTQDSHKELEQKLAAFLGMEDAILYSSCFDANGGLFETLLGAEDAIISDALNHASIIDGVRLCKAKRYRYANNDMQELE 162 Escherichia coli
1FC4_A       166 ARLKEAREAgaRHVLIATDGVFSXDGVIANLKGVCDLADKYDALVXVDDSHAVGFVGENGRGSHEYCDVXGRVDIITGTL 245 Escherichia coli
O75600       186 AKLQEAQKH--RLRLVATDGAFSMDGDIAPLQEICCLASRYGALVFMDECHATGFLGPTGRGTDELLGVMDQVTIINSTL 263 human
WP_011036153 166 TQLQAADAAgcKTKLITSDGVFSMDGFIAPLDEITALARKYNALVHIDECHATGFLGATGRGSAEVKGVMDQIDIFTGTL 245 Xanthomonas cam...
WP_004585010 163 RVLKEAQAQ--RYRIIVTDGVFSMDGNVAPMDKICDLAEKYDAMVMVDECHSAGVVGATGRGVAEQFDCYGRIDIHTGTL 240 Porphyromonas g...
WP_011004253 165 AQLTQARADgaRHLLVFTDGVFSMDGTIARLDEMRSICDAHGALLGIDECHATGFLGPRGRGTHELRGVFGKVDIITGTL 244 Ralstonia solan...
P07912       163 ARLKEAREAgaRHVLIATDGVFSMDGVIANLKGVCDLADKYDALVMVDDSHAVGFVGENGRGSHEYCDVMGRVDIITGTL 242 Escherichia coli
1FC4_A       246 GKALGGASGGYTAARKEVVEWLRQRSRPYLFSNSLAPAIVAASIKVLEXVEAGSELRDRLWANARQFREQXSAAGFTLAG 325 Escherichia coli
O75600       264 GKALGGASGGYTTGPGPLVSLLRQRARPYLFSNSLPPAVVGCASKALDLLMGSNTIVQSMAAKTQRFRSKMEAAGFTISG 343 human
WP_011036153 246 GKAMGGALGGFTTAKREVIELLRQRSRPYLFSNSLPPHVVAAGIKAFEMLDAAGELRTQLVENTRYFRERMTAAGFDVKP 325 Xanthomonas cam...
WP_004585010 241 GKAFGGAIGGFTTGPKEVIAMLRQRSRPYLFSNSIPPSVVGAGLEVFKMLKESNDLHTKLMENVNYFRDRMLAAGFDIKP 320 Porphyromonas g...
WP_011004253 245 GKALGGASGGFTSARKEVVALLRQRSRPYLFSNTVAPAIIGASIAVLDILEGSTELRDRLERNTRFFRAGLEALGFDVKP 324 Ralstonia solan...
P07912       243 GKALGGASGGYTAARKEVVEWLRQRSRPYLFSNSLAPAIVAASIKVLEMVEAGSELRDRLWANARQFREQMSAAGFTLAG 322 Escherichia coli
1FC4_A       326 ADHAIIPVXLGDAVVAQKFARELQKEGIYVTGFFYPVVPKGQARIRTQXSAAHTPEQITRAVEAFTRIGKQLGVI 400 Escherichia coli
O75600       344 ASHPICPVMLGDARLASRMADDMLKRGIFVIGFSYPVVPKGKARIRVQISAVHSEEDIDRCVEAFVEVGRLHGAL 418 human
WP_011036153 326 GVHPISPVMLYDAPLAQRFAERLLEEGIYAIGFFFPVVPKGQARIRTQISAAHTREQLDQAIDAFTRIGHELKVI 400 Xanthomonas campestris
WP_004585010 321 TQSAICAVMLYDAKLSQDYAARLLEEGIYVTGFYYPVVPKGQARIRVQLSAGHEREHLDKAINAFIKVGRELGVI 395 Porphyromonas gingiv...
WP_011004253 325 GEHPIIPIMVYDADKAQQLAQRLLELGVYVVGFFYPVVPKGQARIRVQMSAVHDEAALQAALGAFGQAGHELGLI 399 Ralstonia solanacearum
P07912       323 ADHAIIPVMLGDAVVAQKFARELQKEGIYVTGFFYPVVPKGQARIRTQMSAAHTPEQITRAVEAFTRIGKQLGVI 397 Escherichia coli
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap