3C3D


Conserved Protein Domain Family
F420_cofD

?
TIGR01819: F420_cofD 
Click on image for an interactive view with Cn3D
2-phospho-L-lactate transferase
This model represents LPPG:Fo 2-phospho-L-lactate transferase, which catalyses the fourth step in the biosynthesis of coenzyme F420, a flavin derivative found in methanogens, the Mycobacteria, and several other lineages. This enzyme is characterized so far in Methanococcus jannaschii but appears restricted to F420-containing species and is predicted to carry out the same function in these other species. The clade represented by this model is one of two major divisions of proteins in pfam01933. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other]
Statistics
?
PSSM-Id: 130878
View PSSM: TIGR01819
Aligned: 7 rows
Threshold Bit Score: 410.673
Threshold Setting Gi: 490012269
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3C3D_A         2 IIFSGGTGTPKLLDGLKEILP-------------EEELTVVVNTAEDLWVSGNLISPDLDTVLYLFSDQIDRKRWWGIEN 68  Methanosarcina ...
WP_011033809   2 IIFSGGTGTPKLLDGLKEILP-------------EEELTVVVNTAEDLWVSGNLISPDLDTVLYLFSDQIDRKRWWGIEN 68  Methanosarcina ...
WP_010870769   6 TVLSGGTGTPKLLQGLKRVVN-------------NEELAVIVNTGEDTWIGDLYLSPDVDTVLYTLADLINEETWYGVKE 72  Methanocaldococ...
WP_010878417   2 LVLSGGTGTPKLLQGLKEV----------------ADFWVVVNTAEDVWVSGNKICPDIDSVIYAIAEVIDDEKWWGIKG 65  Archaeoglobus f...
WP_003914950   8 TVLAGGVGGARFLLGVQQLLGlgqfaansahsdaDHQLSAVVNVGDDAWIHGLRVCPDLDTCMYTLGGGVDPQRGWGQRD 87  Mycobacterium t...
WP_010903040   3 TFLAGGTGTPKLLAGARRVFD-------------PAETTVVGNTGDDVALGGLLVCPDLDTVLFEGGGVLDRETWWGIAD 69  Halobacterium s...
WP_003975775   4 VVLAGGIGGARFLRGLRQAAP-------------DADITVIGNTGDDIHLFGLKVCPDLDTVMYTLGGGINEEQGWGRAD 70  Streptomyces
3C3D_A        69 DTFGTYERXKELGI--------------------------------EEGLKLGDRDRATHIIRSNIIRDGASLTDSTVKL 116 Methanosarcina ...
WP_011033809  69 DTFGTYERMKELGI--------------------------------EEGLKLGDRDRATHIIRSNIIRDGASLTDSTVKL 116 Methanosarcina ...
WP_010870769  73 DTFYTHEQLKNLGF--------------------------------DEVLRIGDKDRALKMHKTYYLKRGHKLSEVVDME 120 Methanocaldococ...
WP_010878417  66 DTFHTHERLKELGF--------------------------------DEGMRIGDLDRATHILRSEMLRAGKSLCEATKAV 113 Archaeoglobus f...
WP_003914950  88 ETWHAMQELVRYGVq-------------------------------PDWFELGDRDLATHLVRTQMLQAGYPLSQITEAL 136 Mycobacterium t...
WP_010903040  70 DGSTTHDYLTDLAAaadidpdtprylpddaqtagrdiarwrrfsaaSEFMFIGDRDRAVHTLRAGLLDEGHTLTEVTRRL 149 Halobacterium s...
WP_003975775  71 ETFHLKEELAAYGVg-------------------------------PEWFGLGDRDFATHIVRTQMITAGFPLSAVTEAL 119 Streptomyces
3C3D_A       117 SSLFGIKANILPXSDD--PVSTYIETA----EGIXHFQDFWIGKRGEPDVRGVDIRGVSEASISPKVLEAFEKEENILIG 190 Methanosarcina ...
WP_011033809 117 SSLFGIKANILPMSDD--PVSTYIETA----EGIMHFQDFWIGKRGEPDVRGVDIRGVSEASISPKVLEAFEKEENILIG 190 Methanosarcina ...
WP_010870769 121 KVALGIKAKVIPMTDDrvETKILAKVDg--kVDLLKFHDFWVKRKGDVEVLDVIYENSLYAKPCEKAVEAIKNSDLVIIG 198 Methanocaldococ...
WP_010878417 114 AEAYGVKQEIFPMCEE--EVSTTVVTD----EGEMHFQEFWVLRRGEPEVKDVYFRGIEKARIPDEVKERLRKEKEVLIG 187 Archaeoglobus f...
WP_003914950 137 CDRWQPGARLLPATDDrcETHVVITDPvdesRKAIHFQEWWVRYRAQVPTHSFAFVGAEKSSAATEAIAALADADIIMLA 216 Mycobacterium t...
WP_010903040 150 ADAFDLSVDLVPMSND--PVATIVQTP----DGEQHFQTFWVAEHGDPTVEDVEFRGGERATAAQPAIEAIRDGP-VVVG 222 Halobacterium s...
WP_003975775 120 CDRWKPGVRLIPMTDDrvETHVAVELDg--eRKAVHFQEYWVRLRASVPAEAVVPVGAEQAKPAPGVLEAIGEADVILFP 197 Streptomyces
3C3D_A       191 PSNPITSIGPIISLPGXRELLKK--K--KVVAVSPIIGNAPVSGPAGKLXPACGIEVSSXGVAEYYQD-----F-LDVFV 260 Methanosarcina ...
WP_011033809 191 PSNPITSIGPIISLPGMRELLKK--K--KVVAVSPIIGNAPVSGPAGKLMPACGIEVSSMGVAEYYQD-----F-LDVFV 260 Methanosarcina ...
WP_010870769 199 PSNPITSIGPILSLNGIKELLKD--K--KVVVVSPIVGNSAVSGPAGKLMKAKGYDVSVKGIYEFYKD-----I-VDVLV 268 Methanocaldococ...
WP_010878417 188 PSNPITSILPILSVEDFRERLRD--K--KVIAISPIVGEKAVSGPAGKLMRAKGYEVSARGVADVYAD-----F-LDLLV 257 Archaeoglobus f...
WP_003914950 217 PSNPVVSIGAILAVPGIRAALREatA--PIVGYSPIIGEKPLRGMADTCLSVIGVDSTAAAVGRHYGArcatgI-LDCWL 293 Mycobacterium t...
WP_010903040 223 PSNPVTSIGPMLALDGIADALRD--A--QVVAVSPFVEDEVFSGPAAKLMAAVGHDPSTAGVADAY-D-----F-ADAFV 291 Halobacterium s...
WP_003975775 198 PSNPVVSIGTILAVPGIREAIAD--AgvPVVGLSPIVGDAPVRGMADKVLAAVGVESTAAAVAEHYGS-----GlLDGWL 270 Streptomyces
3C3D_A       261 FDERDRADEFAferlGCHASRADTLXTSTEKSKELAEIVVQ 301 Methanosarcina mazei Go1
WP_011033809 261 FDERDRADEFAferlGCHASRADTLMTSTEKSKELAEIVVQ 301 Methanosarcina mazei
WP_010870769 269 IDNVDKEIAKEi---PCEVLITNTIMKTLDDKVRLAKNIIE 306 Methanocaldococcus jannaschii
WP_010878417 258 VDEADKGVMER-------SVATNTIMKTKEDAVRLAEFVVK 291 Archaeoglobus fulgidus
WP_003914950 294 VHDGDHAEID-----GVTVRSVPLLMTDPNATAEMVRAGCD 329 Mycobacterium tuberculosis
WP_010903040 292 LDTADSTDLDR------PVVRTDTSLDTEADAERVARACRD 326 Halobacterium salinarum
WP_003975775 271 VDTVDADAVTRvraaGVLCRAVPLMMTDLDATAQMAREALT 311 Streptomyces
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap