1ZOY


Conserved Protein Domain Family
sdhA_forward

?
TIGR01816: sdhA_forward 
Click on image for an interactive view with Cn3D
succinate dehydrogenase, flavoprotein subunit, E. coli/mitochondrial subgroup
Succinate dehydrogenase and fumarate reductase are homologous enzymes reversible in principle but favored under different circumstances. This model represents a narrowly defined clade of the succinate dehydrogenase flavoprotein subunit as found in mitochondria, in Rickettsia, in E. coli and other Proteobacteria, and in a few other lineages. However, this model excludes all known fumarate reductases. It also excludes putative succinate dehydrogenases that appear to diverged before the split between E. coli succinate dehydrogenase and fumarate reductase. [Energy metabolism, TCA cycle]
Statistics
?
PSSM-Id: 130875
View PSSM: TIGR01816
Aligned: 7 rows
Threshold Bit Score: 990.034
Threshold Setting Gi: 499190057
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1ZOY_A        38 LSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNME-EDNWRWHFYDTVKGSDWLGDQDAIHYMTEQAPASVVELENYGM 116 pig
P31038        30 MAKEGLNTACITKIFPTRSHTVAAQGGISAALGNMG-EDDWRWHMYDTVKGSDWLGDQDAIEYMCKNAPDAILELEHYGV 108 Rickettsia prow...
WP_010980875  26 LSKSGLNCAVLSKVFPTRSHTVAAQGGISASLGNVQ-EDRWDWHMYDTVKGSDWLGDQDAIEFMCRAAPEAVIELEHMGM 104 Neisseria menin...
P31040        80 LSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNME-EDNWRWHFYDTVKGSDWLGDQDAIHYMTEQAPAAVVELENYGM 158 human
WP_003087407  27 LAQGGHKTAVVTKVFPTRSHTVSAQGGITCAIASADpNDDWRWHMYDTVKGSDYIGDQDAIEYMCSVGPEAVFELEHMGL 106 Pseudomonas
WP_010887597  23 AAKGGVSVACISKLYPTRSHTGAAQGGIGAALGNIQ-EDHWEWHMFDTIKGGDYLTDQDAAEVFSKDIIEVVYELEHMGL 101 Deinococcus rad...
WP_003417273  25 AGPR-VRTAVLTKLYPTRSHTGAAQGGMCAALANVE-DDNWEWHTFDTVKGGDYLADQDAVEIMCKEAIDAVLDLEKMGM 102 Mycobacterium t...
1ZOY_A       117 PFSRTEDGKIYQRAFGGQSLKFGKGgQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLM-E-NGE----CR 190 pig
P31038       109 PFSRTVDGKIYQRPFGGMTTEYGKGkAAQRTCAAADRTGHAILHTLYQQSLKHKVQFFIEYFAIDLLM-E-DGE----CR 182 Rickettsia prow...
WP_010980875 105 PFDRVESGKIYQRPFGGHTAEHGKR-AVERACAVADRTGHAMLHTLYQQNVRANTQFFVEWTAQDLIRdE-NGD----VV 178 Neisseria menin...
P31040       159 PFSRTEDGKIYQRAFGGQSLKFGKGgQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLM-E-NGE----CR 232 human
WP_003087407 107 PFSRTETGRIYQRPFGGQSKDFGKGgQAARTCAAADRTGHALLHTLYQANLKNGTSFLNEWYAVDLVK-NqDGA----VV 181 Pseudomonas
WP_010887597 102 PFSRTPEGKIAQRKFGGHTRDFGKA-AVERSCYAKDRTGHMILQTLYQQNVKAGTLFFNEFHVTDLII-E-DGR----CR 174 Deinococcus rad...
WP_003417273 103 PFNRTPEGRIDQRRFGGHTRDHGKA-PVRRACYAADRTGHMILQTLYQNCVKHDVEFFNEFYALDLAL-T-QTPsgpvAT 179 Mycobacterium t...
1ZOY_A       191 GVIALCIEDGSIHRIRARNTVVATGGYGRTYFSCTSAHTSTGDGTAMVTRAGLPCQDLEFVQFHPTGIYGAGCLITEGCR 270 pig
P31038       183 GVVAWNLDDGSLHCFRAHNVVLATGGYGRAYFSATSAHTCTGDGGGMVIRAGLPLQDMEFVQFHPTGIYSAGCLITEGAR 262 Rickettsia prow...
WP_010980875 179 GVTAMEMETGEVYIFHAKAVMFATGGGGRIYASSTNAYMNTGDGLGICARAGIPLEDMEFWQFHPTGVAGAGVLITEGVR 258 Neisseria menin...
P31040       233 GVIALCIEDGSIHRIRAKNTVVATGGYGRTYFSCTSAHTSTGDGTAMITRAGLPCQDLEFVQFHPTGIYGAGCLITEGCR 312 human
WP_003087407 182 GIIAICIETGETVYIRSKAVVLATGGAGRIYASTTNALINTGDGVGMALRAGVPVQDIEMWQFHPTGIAGAGVLVTEGCR 261 Pseudomonas
WP_010887597 175 GVVAYDLATGELHTFHAKAVILAAGGYGRVFKITSNALTLTGDLMSIYYRKGLPLQDMEFYQFHPTGLAKLGILVTEGIR 254 Deinococcus rad...
WP_003417273 180 GVIAYELATGDIHVFHAKAVVIATGGSGRMYKTTSNAHTLTGDGIGIVFRKGLPLEDMEFHQFHPTGLAGLGILISEAVR 259 Mycobacterium t...
1ZOY_A       271 GEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTLEIREGRGCGPEKDHVYLQLHHLPPEQLAVRLPGISETAMIFAG 350 pig
P31038       263 GEGGYLVNANGERFMERYAPAAKDLASRDVVSRAMTIEIREGRGVGEHKDHVFLHLNHLSPEILHRRLPGISETAKIFAG 342 Rickettsia prow...
WP_010980875 259 GEGGILLNADGERFMERYAPTVKDLASRDVVSRAMAMEIYEGRGCGKNKDHVLLKIDHIGAEKIMEKLPGIREISIQFAG 338 Neisseria menin...
P31040       313 GEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTLEIREGRGCGPEKDHVYLQLHHLPPEQLATRLPGISETAMIFAG 392 human
WP_003087407 262 GEGGYLINAHGERFMERYAPNAKDLAGRDVVARSMVKEVLAGNGVGPNKDHVLLKLDHLGEEVLHSRLPGICELSKTFAH 341 Pseudomonas
WP_010887597 255 GEGGILRNSNGERFMERYAPTIKDLAPRDIVARSMTTEIREGRGVGKDKDAIHIDLTHLPREVIEGKLAEITDLARTYLG 334 Deinococcus rad...
WP_003417273 260 GEGGRLLNGEGERFMERYAPTIVDLAPRDIVARSMVLEVLEGRGAGPLKDYVYIDVRHLGEEVLEAKLPDITEFARTYLG 339 Mycobacterium t...
1ZOY_A       351 VDVTKEPIPVLPTVHYNMGGIPTNYKGQVLR-HVNGQDQVVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALSI 429 pig
P31038       343 VDVTKDPIPVLPTVHYNMGGIPTNYQGQVIIkDGKNHNSIVNGIMAIGEAACVSVHGANRLGSNSLLDLVVFGRSSALKA 422 Rickettsia prow...
WP_010980875 339 IDPIKDPIPVVPTTHYMMGGIPTNYHGEVVVpQGEDYEVPVKGLYAAGECACASVHGANRLGTNSLLDLVVFGKAAGDSM 418 Neisseria menin...
P31040       393 VDVTKEPIPVLPTVHYNMGGIPTNYKGQVLR-HVNGQDQIVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALSI 471 human
WP_003087407 342 VDPVVAPIPVIPTCHYMMGGVATNIHGQAITqDANGNDQIVEGLFAVGEVACVSVHGANRLGGNSLLDLVVFGRAAGLHL 421 Pseudomonas
WP_010887597 335 QDPVKDLVMVQPTAHYAMGGIPTDLNGLCLS-DGNG--GSIEGLYAAGEQACVSLHGANRLGTNSLGDLVVFGRRAGRYA 411 Deinococcus rad...
WP_003417273 340 VDPVTELVPVYPTCHYLMGGIPTTVTGQVLR-D---NTSVVPGLYAAGECACVSVHGANRLGTNSLLDINVFGRRAGIAA 415 Mycobacterium t...
1ZOY_A       430 AESCRPGDKVPSIKPNAGEESVMNLDKLRFANGTIRTSELRLSMQKSMQSHAAVFRVGSVLQEGCEKILRLYGDLQHLKT 509 pig
P31038       423 AELIKPASPHKPLQKETLEKIINRFDKVRYANGNILVADLRLKMQRTMQSHVSVFRTQKLLDEGVGMISEIRNRYKDIKI 502 Rickettsia prow...
WP_010980875 419 IKFIKEQSDWKPLPANAGELTRQRIERLDNQTDGENVDALRRELQRSVQLHAGVFRTDEILSKGVREVMAIAERVKRTEI 498 Neisseria menin...
P31040       472 EESCRPGDKVPPIKPNAGEESVMNLDKLRFADGSIRTSELRLSMQKSMQNHAAVFRVGSVLQEGCGKISKLYGDLKHLKT 551 human
WP_003087407 422 EKALKEGIDARGASESDLEASFKRLNGVNERTSGEEVAPLKRELQSCMQNYFGVFRTGEYMQKGIAQLADLRERIANVKI 501 Pseudomonas
WP_010887597 412 AEYAK-QVEYAEMPENAEAESRRVFDDLRAASGKDNAAAIRKELQETMMRNVGIFRNGPDMAKQVEIIKELKTRYKNVGV 490 Deinococcus rad...
WP_003417273 416 ASYAQ-GHDFVDMPPNPEAMVVGWVSDILSEHGNERVADIRGALQQSMDNNAAVFRTEETLKQALTDIHALKERYSRITV 494 Mycobacterium t...
1ZOY_A       510 FDRGMVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHAREDFKERVDeydyskpiqgqqkkpfqE----------- 578 pig
P31038       503 NDKSLIWNSDLVEALELDNLLDQALVTVCSAAARKESRGAHAREDYPDRND-----------------R----------- 554 Rickettsia prow...
WP_010980875 499 KDKSKVWNTARIEALELDNLIEVAKATLVSAEARKESRGAHASDDHPERDD-----------------E----------- 550 Neisseria menin...
P31040       552 FDRGMVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHAREDYKVRID-----------------Eydyskpiqgqq 614 human
WP_003087407 502 NDKSQAFNTARIEALELQNLLEVAEATAIAAEHRKESRGAHAREDFEERDD-----------------E----------- 553 Pseudomonas
WP_010887597 491 SDTNARYNSELVEALELGFMLDCAEAMASSAVNRTESRGAHDREDFHQRDD-----------------V----------- 542 Deinococcus rad...
WP_003417273 495 HDKGKRFNTDLLEAIELGFLLELAEVTVVGALNRKESRGGHAREDYPNRDD-----------------V----------- 546 Mycobacterium t...
1ZOY_A       579 ------HWRKHTLSYVDVkT---GKVSLEYRPVIDKTLNEADCAtvpPAIRSY 622 pig
P31038       555 ------DWIKHTLSSIDD-S---GKVVLDYKPVTLTTLTDAISAi-pPVKRVY 596 Rickettsia prowazekii str. Madrid E
WP_010980875 551 ------NWMKHTLYHSDIn-------TLSYKPVHTKPLSVEYIK---PAKRVY 587 Neisseria meningitidis
P31040       615 kkpfeeHWRKHTLSYVDVgT---GKVTLEYRPVIDKTLNEADCAtvpPAIRSY 664 human
WP_003087407 554 ------NWLCHTLYFP-------GEKRVSKRSVNFAPKTVPAFE---PKVRTY 590 Pseudomonas
WP_010887597 543 ------NWLKHTMAYRDMnNp--GNVLIGYKDVALKGFTRS-FE---PKPRVY 583 Deinococcus radiodurans
WP_003417273 547 ------NYMRHTMAYKEIgAdkeGPELRSDVRLDFKPVVQTRYE---PKERKY 590 Mycobacterium tuberculosis complex
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap