Conserved Protein Domain Family
TrpE-clade3

?
TIGR01815: TrpE-clade3 
anthranilate synthase, alpha proteobacterial clade
This model represents a small clade of anthranilate synthases from alpha proteobacteria and Nostoc (a cyanobacterium). This enzyme is the first step in the pathway for the biosynthesis of tryprophan from chorismate. [Amino acid biosynthesis, Aromatic amino acid family]
Statistics
?
PSSM-Id: 130874
View PSSM: TIGR01815
Aligned: 3 rows
Threshold Bit Score: 1252.48
Threshold Setting Gi: 1717765
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P15395        13 YTTKGGIVVTRRRREASYSDAIAGYVDRLDERRGAVFSSNYEYPGRYTRWDTAVVDPPLAISSFGRSLWIEAYNERGEVL 92  Sinorhizobium m...
P50872        18 FQTRGGVTVTRRATALDPRTALDPVIDALDRRRGLLLSSGVEAPGRYRRHALGFTDPAVALTARGRTLRIDALNGRGQVL 97  Azospirillum br...
WP_010994590   8 YRTNGNVRVSRSITQVKMETALEEILFYLNSQRGGLLTSSYEYPGRYKRWAIGFVNPPVELSTSGNTFTLTALNERGYVL 87  Nostoc sp. PCC ...
P15395        93 LALIAEDLKSVADITLGSLAARRLDLTINEPdRVFTEEERSKMPTVFTVLRAVTNLFHSEEDSNLGLYGAFGYDLAFQFD 172 Sinorhizobium m...
P50872        98 LPAVAEALRGLEALAGLEEAPSRVTASSASP-APLPGEERSRQPSVFSVLRAVLDLFAAPDDPLLGLYGAFAYDLAFQFE 176 Azospirillum br...
WP_010994590  88 LPVIFECLSKSEQLQKLTEHHHKITGLVKSTpEFFAEEERSKQPSTFTVIREILHIFSSQEDEHLGLYGAFGYDLVFQFE 167 Nostoc sp. PCC ...
P15395       173 AIELKLSRPDDQRDMVLFLPDEILVVDHYAAKAWIDRYDFARENLSTEGKAADIAPEPFRSVDSIPPH-GDHRPGEYAEL 251 Sinorhizobium m...
P50872       177 PIRQRLERPDDQRDLLLYLPDRLVALDPIAGLARLVAYEFITAAGSTEGLECGGRDHPYRPDTNAEAG-CDHAPGDYQRV 255 Azospirillum br...
WP_010994590 168 QITQCLERPQDQRDLVLYLPDELIVVDYYQQQAFRLEYDFITAHGSTYDLPRTGESVDYRGQCLTPPQnADHKIGEYAKL 247 Nostoc sp. PCC ...
P15395       252 VVKAKESFRRGDLFEVVPGQKFYERCESRPSEISNRLKAINPSPYSFFINLGNQEYLVGASPEMFVRVSGRRIETCPISG 331 Sinorhizobium m...
P50872       256 VESAKAAFRRGDLFEVVPGQTFAEPCADAPSSVFRRLRAANPAPYEAFVNLGRGEFLVAASPEMYVRVAGGRVETCPISG 335 Azospirillum br...
WP_010994590 248 VEFALDYFRRGDLFEVVPSQNFFTACEAPPSQLFETLKQINPSPYGFIFNLG-GEYIIGASPEMFVRVEGRRVETCPISG 326 Nostoc sp. PCC ...
P15395       332 TIKRGDDPIADSEQILKLLNSKKDESELTMCSDVDRNDKSRVCVPGSVKVIGRRQIEMYSRLIHTVDHIEGRLRDDMDAF 411 Sinorhizobium m...
P50872       336 TVARGADALGDAAQVLRLLTSAKDAAELTMCTDVDRNDKARVCEPGSVRVIGRRMIELYSRLIHTVDHVEGRLRSGMDAL 415 Azospirillum br...
WP_010994590 327 TITRGHDAIDDAVQIRQLLNSHKDEAELTMCTDVDRNDKSRICEPGSVKVIGRRQIELYSHLIHTVDHVEGILRPEFDAL 406 Nostoc sp. PCC ...
P15395       412 DGFLSHAWAVTVTGAPKLWAMRFIESHEKSPRAWYGGAIGMVGFNGDMNTGLTLRTIRIKDGIAEVRAGATLLYDSNPEE 491 Sinorhizobium m...
P50872       416 DAFLTHSWAVTVTGAPKRWAMQFLEDTEQSPRRWYGGAFGRLGFDGGMDTGLTLRTIRMAEGVAYVRAGATLLSDSDPDA 495 Azospirillum br...
WP_010994590 407 DAFLSHTWAVTVTGAPKRAAIQFIEKNERSVRRWYGGAVGYLNFNGNLNTGLILRTIRLQDSIAEVRVGATLLYDSIPQA 486 Nostoc sp. PCC ...
P15395       492 EEAETELKASAMIAAIRdAKSANSAKSARDVAAVG-------AGVSILLVDHEDSFVHTLANYFRQTGASVTTVRTPVAE 564 Sinorhizobium m...
P50872       496 EDAECRLKAAAFRDAIR-GTAAGAAPTLPAAPRGG-------EGRRVLLVDHDDSFVHTLADYLRQTGASVTTLRHSHAR 567 Azospirillum br...
WP_010994590 487 EEQETITKAAAAFETIRrAKQIDPQIEESSTRKLSkylpdgqSGKHILLIDHEDSFVHTLANYIRSTGATVTTLRHGFSE 566 Nostoc sp. PCC ...
P15395       565 EIFDRVKPDLVVLSPGPGTPKDFDCKATIKKARARDLPIFGVCLGLQALAEAYGGDLRQLAIPMHGKPSRIRVLEPg-IV 643 Sinorhizobium m...
P50872       568 AALAERRPDLVVLSPGPGRPADFDVAGTIDAALALGLPVFGVCLGLQGMVERFGGALDVLPEPVHGKATEVRVLGG--AL 645 Azospirillum br...
WP_010994590 567 SLFDTERPDLVVLSPGPGRPSEFKVQETVAACVRRQIPLFGVCLGLQGIVEAFGGELGVLNYPQHGKSSRIFVTAPdsVM 646 Nostoc sp. PCC ...
P15395       644 FSGLGKEVTVGRYHSIFADPSNLPREFVITAESEDGTIMGIEHSKEPVAAVQFHPESIMTLGGDAGMRMIENVVAHLAKR 723 Sinorhizobium m...
P50872       646 FAGLPERLTVGRYHSLVARRDRLPADLTVTAETADGLVMAVEHRRLPLAAVQFHPESILSLDGGAGLALLGNVMDRLAAG 725 Azospirillum br...
WP_010994590 647 FQDLPESFTVGRYHSLFALSQRLPKELKVTAISDDEVIMAIEHQTLPIAAVQFHPESIMTLAGEVGLMMIKNVVQKYTQS 726 Nostoc sp. PCC ...
P15395       724 AKTKAA 729 Sinorhizobium meliloti 1021
P50872       726 ALTDAA 731 Azospirillum brasilense
WP_010994590 727 QQSTVP 732 Nostoc sp. PCC 7120
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap