Conserved Protein Domain Family
sdhA_Bsu

?
TIGR01811: sdhA_Bsu 
succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup
This model represents the succinate dehydrogenase flavoprotein subunit as found in the low-GC Gram-positive bacteria and a few other lineages. This enzyme may act in a complete or partial TCA cycle, or act in the opposite direction as fumarate reductase. In some but not all species, succinate dehydrogenase and fumarate reductase may be encoded as separate isozymes. [Energy metabolism, TCA cycle]
Statistics
?
PSSM-Id: 130870
View PSSM: TIGR01811
Aligned: 5 rows
Threshold Bit Score: 1040.2
Threshold Setting Gi: 686406594
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011013606  62 VLVVGTGLSGGAAAAALGELGYDVKAFTYHDAPRRAHSIAAQGGVNSARGKKVDNDGAYRHVKDTVKGGDYRGRESDCWR 141 Corynebacterium...
WP_010933916  37 IIVVGTGLAGASAATTLGQLGYNVKSFCYQDTPRRAHSIAAQGGINAAKNYQNDGDNVFRLFYDTIKGGDYRSRESNVYR 116 Chlorobaculum t...
WP_003977936  47 VIVVGTGLAGGSAGATLAEQGYHVVQFCYQDSPRRAHSIAAQGGINAAKNYRNDGDSIHRLFYDTVKGGDFRSRESNVHR 126 Streptomyces
WP_010899236   6 VIVVGGGLAGLMATIKVAEAGVPVELFSLVP-VKRSHSVCAQGGINGAVNTKGEGDSPWEHFDDTVYGGDFLANQPPVKA 84  Bacillus halodu...
WP_031912362   6 LIVVGGGLAGLMSTIKAAEKGAHVDLFSVVP-VKRSHSVCAQGGINGAVNTKGEGDSPWIHFDDTVYGGDFLANQPPVKA 84  Staphylococcus ...
WP_011013606 142 LAVESVRVIDHMNAIGAPFAREYGGALATRSFGGVQVSRTYYTRGQTGQQLQLSTASALQRQIHLGSVEIFTHNEMVDVI 221 Corynebacterium...
WP_010933916 117 LASISPEIIDICVAQGVPFAREYGGLLANRSFGGAQVSRTFYARGQTGQQLLIGAYSAMSRQIAAGTVQLYSRRDVLDIV 196 Chlorobaculum t...
WP_003977936 127 LAQISVEIIDQCVAQGVPFAREYGGLLDTRSFGGVQVSRTFYARGQTGQQLLLGAYQALSRQIAAGTIEMHARTEMLDLI 206 Streptomyces
WP_010899236  85 MCDAAPGIIHLMDRMGVMFNRTAEGLLDFRRFGGTQHHRTAFAGATTGQQLLYALDEQVRRHETSGLVTKYEGWEFISAI 164 Bacillus halodu...
WP_031912362  85 MTEAAPKIIHLLDRMGVMFNRTNEGLLDFRRFGGTLHHRTAYAGATTGQQLLYALDEQVRAYEVDGLVTKYEGWEFLGIV 164 Staphylococcus ...
WP_011013606 222 VTERngekRCEGLIMRNLITGELTAHTGHAVILATGGYGNVYHMSTLAKNSNASAIMRAYEAGAYFASPSFIQFHPTGLP 301 Corynebacterium...
WP_010933916 197 VVDG----KARGIIARNLVTGEIERHSAHAVVLATGGYSNVFYLSTNAMGSNATPAWSAYKKGALFANPCFTQIHPTCIP 272 Chlorobaculum t...
WP_003977936 207 VVDG----RARGIVARDLVTGKIDTYYADAVVLASGGYGNVFYLSTNAMNSNATAVWRAHRRGAYFANPCFTQIHPTCIP 282 Streptomyces
WP_010899236 165 IDDEg---ICRGITAQNLKTSEFQSFSADAVIMATGGPGIIFGKSTNSVINTGYAAAKLYEQGVYYANGEFIQIHPTAIP 241 Bacillus halodu...
WP_031912362 165 KGDDd---SARGIVAQNMTTAEIETFGSDAVIMATGGPGIIFGKTTNSMINTGSAASIVYQQGAIYANGEFIQIHPTAIP 241 Staphylococcus ...
WP_011013606 302 VNSTWQSKTILMSESLRND-GRIWSPKEPNDNRDPNT-------IPEDERDYFLERRYPAFGNLVPRDVASRAISQQINA 373 Corynebacterium...
WP_010933916 273 VHGEFQSKLTLMSESLRND-GRIWVPKEKSDAELIRQkklrpeqIHESKRDYYLERRYPAFGNLVPRDVASRAAKERCDA 351 Chlorobaculum t...
WP_003977936 283 RTGDHQSKLTLMSESLRND-GRIWVPKAKGDDRPANK-------IPEDERDYYLERIYPSFGNLVPRDIASRAAKNVCDE 354 Streptomyces
WP_010899236 242 GD----DKLRLMSESARGEgGRVWTYK-------------------DGKPWYFLEEKYPAYGNLVPRDIATREIFHVCVD 298 Bacillus halodu...
WP_031912362 242 GD----DKLRLMSESARGEgGRIWTYK-------------------DGKPWYFLEEKYPDYGNLVPRDIATREIFDVCIN 298 Staphylococcus ...
WP_011013606 374 GLGVGPLNNAAYLDFRDATERLGQDTIRERYSNLFTMYEEAIGEDPYSSPMRIAPTCHFTMGGLWTDFNEMTSLPGLFCA 453 Corynebacterium...
WP_010933916 352 GFGVGSTGLAVYLDFGDAIERLGRAEISARYGNLFQMYQRIVDDNPYRTPMMIYPAVHYTMGGLWVDYELMTTVPGLYSI 431 Chlorobaculum t...
WP_003977936 355 GRGVGPGGQGVYLDFADAIKRMGRKAVEAKYGNLFDMYQRITDEDPYRVPMRIYPAVHYTMGGLWVDYDLQTTVPGLFAI 434 Streptomyces
WP_010899236 299 LKLGINGENMVYLDLSHKDP----KELDIKLGGIIEIYEKFMGDDPRKVPMKIFPAVHYSMGGMWIDYDQMTNIPGLFAA 374 Bacillus halodu...
WP_031912362 299 QKLGINGENMVYLDLSHKDP----HELDVKLGGIIEIYEKFTGDDPRKVPMKIFPAVHYSMGGLYVDYDQMTNIKGLFAA 374 Staphylococcus ...
WP_011013606 454 GEASWTYHGANRLGANSLLSASVDGWFTLPFTIPNYLGPLLGSERLSEDAPEAQAAIARAQARIDRLMGNRpewvGDnvH 533 Corynebacterium...
WP_010933916 432 GECNFSDHGANRLGASALMQGLADGYFVLPYTISNYLSHEINTPPIPTTLPEFHLAARDVTDRLDRLKKSN----GK--E 505 Chlorobaculum t...
WP_003977936 435 GEANFSDHGANRLGASALMQGLADGYFVLPATINDYLARNPLGDDVDDDHPVVQEVLAETEDRLNLLLSVD----GD--R 508 Streptomyces
WP_010899236 375 GECDYSQHGANRLGANSLLSAIFGGMVAGPKAVEYMNGLEKSAESMPSS--LFEGELKKEQEKFDDILKMD----GK--E 446 Bacillus halodu...
WP_031912362 375 GECDFSQHGGNRLGANSLLSAIYGGTVAGPNAIDYISNIDRSYTDMDES--IFEKRKAEEQERFDKLLAMR----GT--E 446 Staphylococcus ...
WP_011013606 534 GPEYYHRQLGDILYFSCGVSRNVEDLQDGINKIRALRDDFWKNMRITGSTDEMNQVLEYAARVADYIDLGELMCVDALDR 613 Corynebacterium...
WP_010933916 506 SVDHFHRKLGKIMWEYCGMSRNEAGLTKALGLIEELKAEFASGVNIPGGLKEYNPELEKACRVEDFIELGDLMVRDALHR 585 Chlorobaculum t...
WP_003977936 509 TPDSFHRELGELMWEFCGMARTDSGLRKALERIPQIREEFWRRIKVPGTGEEFNQSLEKANRIVDYLELAELMCLDALHR 588 Streptomyces
WP_010899236 447 NAYVLHKELGEWMTDNVTVVRYNDKLLKTDEKIQELMERY-KNIDINDTAKWSNQGASFTRQLDGMLKLARVITLGAYNR 525 Bacillus halodu...
WP_031912362 447 NAYKLHRELGEIMTANVTVVRENEKLLETDKKIVELMKRYED-IDMEDTQTWSNQAVFFTRQLWNMLVLARVITIGAYNR 525 Staphylococcus ...
WP_011013606 614 DESCGAHFRDDHLSEDGEAERDDENWCFVSAWEP-GENGTFVRHAEPLFFESVPLQTRNY 672 Corynebacterium glutamicum
WP_010933916 586 KESCGGHFREEYQTPDHEALRNDDEFAYVAAWEYkGRNDEPEMHREELRFETVTPSQRSY 645 Chlorobaculum tepidum
WP_003977936 589 AESCGGHFREESQTPDGEAARRDEEFGYAAAWEFtGTGDAPTLHKEDLVFEYVHPTQRSY 648 Streptomyces
WP_010899236 526 NESRGAHYKPDFP------ERNDEEFLKTTKAKFnPETLAPEFEYEEVDVSLIEPRKRDY 579 Bacillus halodurans
WP_031912362 526 NESRGAHYKPEFP------ERNDEEWLKTTMASFqGAFEKPQFTYDDVDVSLIPPRKRDY 579 Staphylococcus aureus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap