Conserved Protein Domain Family
CM_P2

?
TIGR01807: CM_P2 
chorismate mutase domain of proteobacterial P-protein, clade 2
This model represents one of two separate clades of the chorismate mutase domain of the gamma and beta and epsilon proteobacterial "P-protein" which contains an N-terminal chorismate mutase domain and a C-terminal prephenate dehydratase domain. It is also found in Aquifex aolicus. [Amino acid biosynthesis, Aromatic amino acid family]
Statistics
?
PSSM-Id: 130866
View PSSM: TIGR01807
Aligned: 5 rows
Threshold Bit Score: 113.699
Threshold Setting Gi: 499310081
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P27603         7 LKALRVRIDSLDERILDLISERARCAQEVARVKTASWpkaEEAVFYRPEREAWVLKHIMELNKGPLDNEEMARLFREIM 85  Pseudomonas stut...
WP_011711876  13 LVELRDGIDAIDDRIHDLLMKRAELVMRVGELKGKGP---AGTPFYRPEREAQIHRRLEGRHGGPLPVEAVHRIFREII 88  Magnetococcus ma...
WP_003676687  22 LLPHRNAIDTIDAEILRLLNERAQHAHAIGELKGTGA-------VYRPEREVAVLRRIQDLNKGPLPDESVARLFREVM 93  Neisseria cinerea
WP_002859423   4 LEEFRNKIDAVDDKILDLLNERMTYVKSIGELKQS-----SGGSIYRPERERAIINRLKNANLGLLDQNAIEAIYQEIF 77  Campylobacter je...
WP_011000856  20 laplraQIDAIDSQLLTLLSDRAKVAQAVGEVKKHYA---SPAF--RPDRELQVIRKMQSGNPGPLHGESIAAIWREVM 93  Ralstonia solana...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap