2F6L


Conserved Protein Domain Family
CM_mono2

?
TIGR01806: CM_mono2 
Click on image for an interactive view with Cn3D
chorismate mutase, putative
This model represents a clade of probable chorismate mutases from alpha, beta and gamma proteobacteria as well as Mycobacterium tuberculosis and a clade of nematodes. Although the most likely function for the enzymes represented by this model is as a chorismate mutase, in no species are these enzymes the sole chorismate mutase in the genome. Also, in no case are these enzymes located in a region of the genome proximal to any other enzymes involved in chorismate pathways. Although the Pantoea enzyme has been shown to complement a CM-free mutant of E. coli, this was also shown to be the case with isochorismate-pyruvate lyase which only has a secondary (non-physiologically relevant) chorismate mutase activity. This enzyme is believed to be a homodimer and be localized to the periplasm. [Amino acid biosynthesis, Aromatic amino acid family]
Statistics
?
PSSM-Id: 130865
View PSSM: TIGR01806
Aligned: 8 rows
Threshold Bit Score: 111.751
Threshold Setting Gi: 686117547
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2F6L_A         1 DGTSQLAELVDAAAERLEVADPVAAFKWRAQLPIEDSGRVEQQLAKLGEDARSQHIDPDYVTRVFDDQIRATEAIEYSRF 80  Mycobacterium t...
P42517        23 VSSVSLGSLSSALNERMQVMKAVAGYKALHHLPIEDLPREQVVLDHMLQNAQQAGLEPHSVEPFVHALMNASKTIQYRYR 102 Pantoea agglome...
AAD42163      25 DTNADIDRFVEIADDRLTLSDYVALYKIVNNQSITDPKREEKLLDDMRSKGKNLSLSEDYVTLIFQDQINASKYFQNYLV 104 root-knot nematode
WP_002211366  28 VQAQQCGQTAPLINERLSYMKDVAGYKAENHLPIEDRIQEEKVINSAMAQAESLGLNGESIKPLMVAQINAAKAIQYRYR 107 Yersinia
KAM12025      34 DGTSQLAELVDAAAERLEVADPVAAFKWRAQLPIEDSGRVEQQLAKLGEDARSQHIDPDYVTRVFDDQIRATEAIEYSRF 113 Mycobacterium t...
WP_003484013  29 rsqPPLDLLMDRIVQRNAIGDAVALSKWDSGKPVLDQAREAAVLQSVRDQAPAHGLDADDAARFFGAQIEANKSVQYALL 108 Xanthomonas
WP_031766549  22 PLSPALQQLLSLSSQRLQLADQVAQSKAQSGKAVQDSPREEQQLQMLAGQAGSHGVGAEQVRLLFAAQIEANKLVQYRLL 101 Pseudomonas aer...
AAM74953      91 TQGTATLFIVGVANKRLMLAKDVVNYKFHQNISIDDFEREKQVLESVSAQGQKAGIGDNYGEKFFQDQMDANKMIQKGSV 170 soybean cyst ne...
2F6L_A        81 SDWkL-NPASAPPEPPDLS-ASRSAIDSLNNRMLSQI 115 Mycobacterium tuberculosis H37Rv
P42517       103 ADW-L-SSPDSAVPVRDLT-ETRQQIQQLDTQLLTAI 136 Pantoea agglomerans
AAD42163     105 NLW-N-QTGIPPIKVRNLNtDLRPAIDQINTEMLQLL 139 root-knot nematode
WP_002211366 108 ADW-L-SQPEPGWQPKPLD-DVRANIGELSTKILEQI 141 Yersinia
KAM12025     114 SDWkL-NPASAPPEPPDLS-ASRSAIDSLNNRMLSQI 148 Mycobacterium tuberculosis M2352
WP_003484013 109 NRW-ReRGRAPNTARPDLT-ALRARLDQLQGELLDAL 143 Xanthomonas
WP_031766549 102 S-----RPLPDAGQAVDLE-RIRSRLNQLNLELLRGY 132 Pseudomonas aeruginosa
AAM74953     171 KLW-TaNKSLPPQNVPDLQkDTRPKVTAATEEMILAL 206 soybean cyst nematode
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap