Conserved Protein Domain Family
CM_mono_grmpos

?
TIGR01805: CM_mono_grmpos 
monofunctional chorismate mutase, gram positive-type, clade 2
This model represents a clade of chorismate mutase proteins/domains from gram positive species. The sequence from Enterococcus is fused to the C-terminus of an aparrent acetyltransferase, and the seuence from Clostridium acetobutylicum (but not perfringens) is fused to the N-terminus of shikimate-5-dehydrogenase, another enzyme of the chorismate pathway. All the other members of this clade are mono-functional. Members of this clade from Streptococcus and Lactococcus have been found which represent the sole chorismate mutase domain in their respective genomes which also exhibit evidence of the enzymes of both the upstream and downstream branches of the chorismate pathways. [Amino acid biosynthesis, Aromatic amino acid family]
Statistics
?
PSSM-Id: 130864
View PSSM: TIGR01805
Aligned: 4 rows
Threshold Bit Score: 78.664
Threshold Setting Gi: 19713464
Created: 8-Oct-2014
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAK78873       4 LEEIRKEIDEVDKIITELFEKRMNLVMEVAEYKEKNSIPVSDSKREKKVIDKNIGYLKNKEySEVLKEFYINFMNLSKKL 83  Clostridium ace...
AAL94257       5 LELMRKKIDEIDDKLLVLFKERLEVSKKIGLLKKKNKIEIFDPQREQEIIDSCTKNISEDE-RIYIEKFLRNLMDISKEV 83  Fusobacterium n...
EET95245     161 LEQQRAKINQIDKELVRLLEQRMDVVAEIAAVKKKAGHAVFDSEREQQVLETILNHVENAEyEETLSETFQGIMDASKRF 240 Enterococcus fa...
WP_000362440   3 LDIIRQEIDQIDDQIVKLLEERMHLVEGVVAYKKASGKPILDTKREEVIFEKVRSRVEDKRyQETIVATFSDILKRSRDY 82  Streptococcus
AAK78873      84 E 84  Clostridium acetobutylicum ATCC 824
AAL94257      84 Q 84  Fusobacterium nucleatum subsp. nucleatum ATCC 25586
EET95245     241 Q 241 Enterococcus faecalis T1
WP_000362440  83 Q 83  Streptococcus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap