2H9C


Conserved Protein Domain Family
CM-like

?
TIGR01803: CM-like 
Click on image for an interactive view with Cn3D
chorismate mutase related enzymes
This subfamily includes two enzymes which are variants on the mechanism of chorismate mutase and are likely to have evolved from an ancestral chorismate mutase enzyme. 4-amino-4-deoxy-chorismate mutase produces amino-deoxy-prephenate which is subsequently converted to para-dimethylamino-phenylalanine, a component of the natural product pristinamycin. Isochorismate-pyruvate lyase presumably catalyzes the same type of 2+2+2 cyclo-rearrangement as chorismate mutase, but acting on isochorismate, this results in two broken bonds instead of one broken and one made. The product of this reaction is salicylate (2-hydroxy-benzoate) which is also incorporated into various natural products.
Statistics
?
PSSM-Id: 130862
View PSSM: TIGR01803
Aligned: 4 rows
Threshold Bit Score: 105.367
Threshold Setting Gi: 302607842
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2H9C_A        10 LADIREAIDRIDLDIVQALGRRMDYVKAASRFKAS-EAAIPAPERVAAMLPERARWAEENGLDAPFVEGLFAQIIHWYIA 88  Pseudomonas aer...
WP_014528930  43 MADIRVEIDRLDRALMTLFAERWGYIERAAEIKRPlNLKADIPARVAEVKENARRNAVELGLDPDFYERFWGQLVERAIA 122 Sinorhizobium m...
Q51507        10 LADIREAIDRIDLDIVQALGRRMDYVKAASRFKAS-EAAIPAPERVAAMLPERARWAEENGLDAPFVEGLFAQIIHWYIA 88  Pseudomonas aer...
CBW45753      22 LDALRARLDAADAALLDAVRTRLDICLRIGEYKRLhQVPMMQPHRIAQVHANAARYAADHGIDPAFLRTLYDTIITETCR 101 Streptomyces pr...
2H9C_A        89 EQ 90  Pseudomonas aeruginosa PAO1
WP_014528930 123 HE 124 Sinorhizobium meliloti
Q51507        89 EQ 90  Pseudomonas aeruginosa PAO1
CBW45753     102 LE 103 Streptomyces pristinaespiralis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap