Conserved Protein Domain Family
CM_A

?
TIGR01801: CM_A 
chorismate mutase domain of gram positive AroA protein
This model represents a small clade of chorismate mutase domains N-terminally fused to the first enzyme in the chorismate pathway, 2-dehydro-3-deoxyphosphoheptanoate aldolase (DAHP synthetase, AroA) which are found in some gram positive species and Deinococcus. Only in Deinococcus, where this domain is the sole CM domain in the genome can a trusted assignment of function be made. In the other species there is at least one other trusted CM domain present. The similarity between the Deinococcus gene and the others in this clade is sufficiently strong (~44% identity), that the whole clade can be trusted to be functional. The possibility exists, however, that in the gram positive species the fusion to the first enzyme in the pathway has evolved a separate, regulatory role. [Amino acid biosynthesis, Aromatic amino acid family]
Statistics
?
PSSM-Id: 130860
View PSSM: TIGR01801
Aligned: 3 rows
Threshold Bit Score: 172.4
Threshold Setting Gi: 486359694
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P39912         1 MSNT-ELELLRQKADELNLQILKLINERGNVVKEIGKAKEAQG-VNRFDPVRERTMLNNIIENNDGPFENSTIQHIFKEI 78  Bacillus subtil...
WP_010887644  11 MTQQrSIDDLRAEVDQINRDLLALISRRGEVVAQIGHAKSAEGrPNHYDPAREEQQLKELEKINPGPFPTATVKGIFKEI 90  Deinococcus rad...
WP_001593384   1 MSN--KLESYRSEIVSLNHQILDLLSKRGELAQKIGEEKLKQG-TRIYDPQREKEMLNDLIDSNKGPFNDNTIKQLFKEI 77  Staphylococcus ...
P39912        79 FKAGLELQEEDHSKALLVSRKKKP 102 Bacillus subtilis subsp. subtilis str. 168
WP_010887644  91 FRASLALEESNDKKQLLVSRKVKR 114 Deinococcus radiodurans
WP_001593384  78 FKASTDLQKSENEKHLYVSRKLKP 101 Staphylococcus aureus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap