1AJ8,3O8J,2R26


Conserved Protein Domain Family
cit_synth_II

?
TIGR01800: cit_synth_II 
Click on image for an interactive view with Cn3D
2-methylcitrate synthase/citrate synthase II
Members of this family are dimeric enzymes with activity as 2-methylcitrate synthase, citrate synthase, or both. Many Gram-negative species have a hexameric citrate synthase, termed citrate synthase I (TIGR01798). Members of this family (TIGR01800) appear as a second citrate synthase isozyme but typically are associated with propionate metabolism and synthesize 2-methylcitrate from propionyl-CoA; citrate synthase activity may be incidental. A number of species, including Thermoplasma acidophilum, Pyrococcus furiosus, and the Antarctic bacterium DS2-3R have a bifunctional member of this family as the only citrate synthase isozyme.
Statistics
?
PSSM-Id: 130859
View PSSM: TIGR01800
Aligned: 12 rows
Threshold Bit Score: 550.43
Threshold Setting Gi: 116476
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1AJ8_A         3 KGLEDVYIDQTNICYIDGKEG--KLYYRGYSVEELAEL-ST-FEEVVYLLWWGKLPSLSELENFKKELAKSRGLPKEVIE 78  Pyrococcus furi...
Q8NSH7         8 KGLNGVISDYTSISKVMPESN--SLTYRGYAVEDLVEN-CS-FEEVIYLLWFGELPTTEQLRTFNTTGRSYRSLDAGLIS 83  Corynebacterium...
P39120         5 RGLEGVVATTSSVSSIIDDT----LTYVGYDIDDLTEN-AS-FEEIIYLLWHLRLPNKKELEELKQQLAKEAAVPQEIIE 78  Bacillus subtil...
Q53554         9 KGLEDVYIDQTNICYIDGKEG--KLYYRGYSVEELAEL-ST-FEEVVYLLWWGKLPSLSELENFKKELAKSRGLPKEVIE 84  Pyrococcus furi...
P21553         9 KGLEDVNIKWTRLTTIDGNKG--ILRYGGYSVEDIIAS-GAqDEEIQYLFLYGNLPTEQELRKYKETVQKGYKIPDFVIN 85  Thermoplasma ac...
WP_010887403  40 KGLEGVLFTESKLTFINGSEG--ILTHLGIPIQEWAEK-ST-FEELSLALLDAKLPTAEELAKFDAELKANRAIPDQLVG 115 Deinococcus rad...
WP_001271319  10 AGLRGQSAGSTALCTVGKTGT--GLTYRGYDITDLAHH-AQ-FEEVAHLLLVGYLPTQAELDQYKTRLIGLRGLPEKLKQ 85  Vibrio cholerae
P31660        20 VALSGVPAGNTALCTVGKSGN--DLHYRGYDILDLAKH-CE-FEEVAHLLIHGKLPTRDELAAYKTKLKALRGLPANVRT 95  Escherichia col...
WP_010878837   3 DGLEDVIACKTTISRIALENGraILEYRGYDIRDLARK-AS-YEEVAYLLLYGELPKKYELQDFKIELAERRELPPQIIG 80  Archaeoglobus f...
3O8J_A        35 VALSGVPAGNTALCTVGKSGN--DLHYRGYDILDLAEH-CE-FEEVAHLLIHGKLPTRDELNAYKSKLKALRGLPANVRT 110 Salmonella ente...
WP_010903548   7 KGLEDVLVAESDLSFIDGDAG--KLVYCGYAIEDLART-AS-YEEVLYLLWHGDLPTRSELDAFRADMASHREIDDDVLA 82  Halobacterium s...
2R26_A         8 KGLEDVNIKWTRLTTIDGNKG--ILRYGGYSVEDIIASgAQ-DEEIQYLFLYGNLPTEQELRKYKETVQKGYKIPDFVIN 84  Thermoplasma ac...
1AJ8_A        79 IMEALPK-NTHPMGA-LRTIISYLGNIDDSgDIPVTPEEVYRIGISVTAKIPTIVANWYRIKNGLEYVPPK-EK--LSHA 153 Pyrococcus furi...
Q8NSH7        84 LIHSLPN-TCHPMDV-LRTAVSYMGTFDPD-PFTRDADHIRSIGHNLLAQLPMVVAMDIRRRSGEEIIAPD-HN--KGIA 157 Corynebacterium...
P39120        79 HFKSYSLeNVHPMAA-LRTAISLLGLLDSE-ADTMNPEANYRKAIRLQAKVPGLVAAFSRIRKGLEPVEPR-ED--YGIA 153 Bacillus subtil...
Q53554        85 IMEALPK-NTHPMGA-LRTIISYLGNIDDSgDIPVTPEEVYRIGISVTAKIPTIVANWYRIKNGLEYVPPK-EK--LSHA 159 Pyrococcus furi...
P21553        86 AIRQLPR-ESDAVAM-QMAAVAAMAASET--KFKWNKDTDRDVAAEMIGRMSAITVNVYRHIMNMPAELPK-PS--DSYA 158 Thermoplasma ac...
WP_010887403 116 IIRDMPK-GVHPMQA-LRTAVSYLGLLDPQ-AEDITPEARRAISTRMIAQFSTIIAAINRAQEGQDIVAPR-AD--LTHA 189 Deinococcus rad...
WP_001271319  86 ALELIPA-EAHPMDV-MRTGCSILGNLEPE----HTFAEQQAATERMLALFPAIICYWYRFSHEGVRIDTA-DQseDSIG 158 Vibrio cholerae
P31660        96 VLEALPA-ASHPMDV-MRTGVSALGCTLPE-KEGHTVSGARDIADKLLASLSSILLYWYHYSHNGERIQPE-TDd-DSIG 170 Escherichia col...
WP_010878837  81 LLTHLPP-YTHPMVV-LRTATSYLGSLDKK-IAVRTREETFNKAKDLIAKFPTIVAYYHRIRTGRNIIPPA-LE--FSHA 154 Archaeoglobus f...
3O8J_A       111 VLEALPA-ASHPMDV-MRTGVSALGCTLPE-KEGHTVSGARDIADKLLASLSSILLYWYHYSHNGERIQPEtDD--DSIG 185 Salmonella ente...
WP_010903548  83 LVENLAA-ADADPMAaLRTAASALSAHDDT-AGGSDPDDARESGKRITAKLPTIVAAFTRLRNGDDVVAPR-DD--LGHA 157 Halobacterium s...
2R26_A        85 AIRQLPR-ESDAVAM-QMAAVAAMAASET--KFKWNKDTDRDVAAEMIGRMSAITVNVYRHIMNMPAELPK-PS--DSYA 157 Thermoplasma ac...
1AJ8_A       154 ANFLYMLHGE-----EPPKEWEKAMDVALILYAEHEINASTLAVMTVGSTLSDYYSAILAGIGALKGPIHGGAVEEAIKQ 228 Pyrococcus furi...
Q8NSH7       158 SNFLSMVFGNddgsvANSADDIRDFERSLILYAEHSFNASTFSARVISSTRSDTYSAITGAIGALKGPLHGGANEFVMHT 237 Corynebacterium...
P39120       154 ENFLYTLNGE-----EPSPIEVEAFNKALILHADHELNASTFTARVCVATLSDIYSGITAAIGALKGPLHGGANEGVMKM 228 Bacillus subtil...
Q53554       160 ANFLYMLHGE-----EPPKEWEKAMDVALILYAEHEINASTLAVMTVGSTLSDYYSAILAGIGALKGPIHGGAVEEAIKQ 234 Pyrococcus furi...
P21553       159 ESFLNAAFGR-----KATKEEIDAMNTALILYTDHEVPASTTAGLVAVSTLSDMYSGITAALAALKGPLHGGAAEAAIAQ 233 Thermoplasma ac...
WP_010887403 190 GNFLYMLTGN-----EPTPEQARLFDIALVLHADHGMNASTFTAIATSSTLSDMYSCMVSAIGALKGPLHGGANEAVMTM 264 Deinococcus rad...
WP_001271319 159 GYFLKMLTGQ-----APSELFKKVMHCSLTLYAEHEFNASTFAARVCASTLSDIHSCVTGAIGTLRGPLHGGANEAAMAM 233 Vibrio cholerae
P31660       171 GHFLHLLHGE-----KPSQSWEKAMHISLVLYAEHEFNASTFTSRVIAGTGSDMYSAIIGAIGALRGPKHGGANEVSLEI 245 Escherichia col...
WP_010878837 155 ANFLYMLHGE-----EPTKTAERALDMDLILHAEHELNASTFAARIAASTLADIYACVVAATGTLMGPLHGGAAQEVMRM 229 Archaeoglobus f...
3O8J_A       186 GHFLHLLHGE-----KPTQSWEKAMHISLVLYAEHEFNASTFTSRVIAGTGSDVYSAIIGAIGALRGPKHGGANEVSLEI 260 Salmonella ente...
WP_010903548 158 ANFLYMLNGE-----APDDVLADVFDQALVLHADHGLNASTFSGMVTASTLADVHAAVTSAIGTLSGSLHGGANANVMRM 232 Halobacterium s...
2R26_A       158 ESFLNAAFGR-----KATKEEIDAMNTALILYTDHEVPASTTAGLVAVSTLSDMYSGITAALAALKGPLHGGAAEAAIAQ 232 Thermoplasma ac...
1AJ8_A       229 FMEIGSPEK-VEEWFFKALQQ-KRKIMGAGHRVYK-TYDPRARIFKKYASKLGDK-----KLFEIAERLERLVEE---Yl 297 Pyrococcus furi...
Q8NSH7       238 MLDIDDPNN-AADWMGKALDR-KERIMGFGHRVYK-NGDSRVPSMEKSMRSLAARhr-gqKWVHMYESMQEVMEA---R- 309 Corynebacterium...
P39120       229 LTEIGEVEN-AEPYIRAKLEK-KEKIMGFGHRVYK-HGDPRAKHLKEMSKRLTNLtg-esKWYEMSIRIEDIVTS---E- 300 Bacillus subtil...
Q53554       235 FMEIGSPEK-VEEWFFKALQQ-KRKIMGAGHRVYK-TYDPRARIFKKYASKLGDKk-----LFEIAERLERLVEEylsK- 305 Pyrococcus furi...
P21553       234 FDEIKDPAM-VEKWFNDNIINgKKRLMGFGHRVYK-TYDPRAKIFKGIAEKLSSKkpevhKVYEIATKLEDFGIKafgS- 310 Thermoplasma ac...
WP_010887403 265 LDEIGTVDK-AEAYITGKLDN-KEKIMGVGHRVYK-YFDPRSRVLRDYAEHVANKeg-ksNYYQILEAIEKIIVD---Rm 337 Deinococcus rad...
WP_001271319 234 IEQWHSADE-AEAGIMRMLAS-KEKIMGFGHAIYR-ESDPRNALIKEWSKALSEAvg-dsHLYAVSERVEAVMKR---E- 305 Vibrio cholerae
P31660       246 QQRYETPDE-AEADIRKRVEN-KEVVIGFGHPVYT-IADPRHQVIKRVAKQLSQEgg-slKMYNIADRLETVMWE---S- 317 Escherichia col...
WP_010878837 230 LREVASPRR-AEEYVKRKIEA-GERIMGFGHRVYRgVMDPRAELLRYLAKRL-AAeg-stKWFEISEAIAKAAYK---Y- 301 Archaeoglobus f...
3O8J_A       261 QQRYETPDE-AEADIRKRVEN-KEVVIGFGHPVYT-IADPRHQVIKRVAKQLSEEgg-slKMYHIADRLETVMWE---T- 332 Salmonella ente...
WP_010903548 233 LKEVDDSDKdPLSWVQDALAN-GERVMGFGHRVYN-VKDPRAHILSERSEELGAAag-dtKWYEMSVAIEDYMAD---E- 305 Halobacterium s...
2R26_A       233 FDEIKDPAM-VEKWFNDNIINgKKRLMGFGHRVYK-TYDPRAKIFKGIAEKLSSKkpevhKVYEIATKLEDFGIKafgS- 309 Thermoplasma ac...
1AJ8_A       298 skKGISINVDYWSGLVFYGMKIPIE--LYTTIFAMGRIAGWTAHLAEYV-S-HNRIIRPRLQYVGEIGKKYLPIELR 370 Pyrococcus furiosus
Q8NSH7       310 --TGIKPNLDFPAGPAYYMLGFPVD--FFTPLFVLARVSGWTAHIVEQF-E-NNALIRPLSAYNGVEEREVVPISER 380 Corynebacterium gl...
P39120       301 --KKLPPNVDFYSASVYHSLGIDHD--LFTPIFAVSRMSGWLAHILEQY-D-NNRLIRPRADYTGPDKQKFVPIEER 371 Bacillus subtilis ...
Q53554       306 --KGISINVDYWSGLVFYGMKIPIE--LYTTIFAMGRIAGWTAHLAEYV-S-HNRIIRPRLQYVGEIGKKYLPIELR 376 Pyrococcus furiosu...
P21553       311 --KGIYPNTDYFSGIVYMSIGFPLRnnIYTALFALSRVTGWQAHFIEYV-EeQQRLIRPRAVYVGPAERKYVPIAER 384 Thermoplasma acido...
WP_010887403 338 gaKGIYPNVDFYSGTVYSDLGIKKE--YFTPIFALARISGWCASVIEYS-Q-DNRLLRPDAEYTGARDQHYVDIKDR 410 Deinococcus radiod...
WP_001271319 306 --KDLFCNADFFHASAYHFMGIPTK--LFTPIFVMSRLTGWAAHVYEQR-A-NNRIIRPSADYVGPEHQTWLPIEQR 376 Vibrio cholerae
P31660       318 --KKMFPNLDWFSAVSYNMMGVPTE--MFTPLFVIARVTGWAAHIIEQR-Q-DNKIIRPSANYVGPEDRPFVALDKR 388 Escherichia coli K-12
WP_010878837 302 --KKLLPNVDFYSASVYANLGIPDD--LFVNIFAMGRISGWTAHIIEQY-E-NNRLIRPRAEYVGEKEKKFIPLSKR 372 Archaeoglobus fulg...
3O8J_A       333 --KKMFPNLDWFSAVSYNMMGVPTE--MFTPLFVIARVTGWAAHIIEQR-Q-DNKIIRPSANYTGPEDRPFVSIDDR 403 Salmonella enteric...
WP_010903548 306 --KGLAPNVDFYSASTYYQMGIPVD--IYTPIFAMSRVGGWVGHVLEQY-D-DNRLIRPRARYVGAEDRDSTPLDER 376 Halobacterium sali...
2R26_A       310 --KGIYPNTDYFSGIVYMSIGFPLRnnIYTALFALSRVTGWQAHFIEYVeE-QQRLIRPRAVYVGPAERKYVPIAER 383 Thermoplasma acido...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap