Conserved Protein Domain Family
CM_T

?
TIGR01799: CM_T 
chorismate mutase domain of T-protein
This model represents the chorismate mutase domain of the gamma proteobacterial "T-protein" which consists of an N-terminal chorismate mutase domain and a C-terminal prephenate dehydrogenase domain. [Amino acid biosynthesis, Aromatic amino acid family]
Statistics
?
PSSM-Id: 130858
View PSSM: TIGR01799
Aligned: 3 rows
Threshold Bit Score: 151.588
Threshold Setting Gi: 136592
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P07023         5 LTALRDQIDEVDKALLNLLAKRLELVAEVGEVKSRFGLPIYVPEREASMLASRRAEAEALGVPPDLIEDVLRRVMRESYS 84  Escherichia col...
P43902         7 LKDLRSEIDSLDRELIQLFAKRLELVSQVGKVKHQHGLPIYAPEREIAMLQARRLEAEKAGISADLIEDVLRRFMRESYA 86  Haemophilus inf...
WP_011071570   9 LEHLRGLIDGVDQQLLHLLRKRLDLVAQVGTVKHAAGLPIYAPQREAAMLAKRREEAQTMGIAPQLIEDILRRLMRESYL 88  Shewanella onei...
P07023        85 SEN 87  Escherichia coli K-12
P43902        87 NEN 89  Haemophilus influenzae Rd KW20
WP_011071570  89 NEK 91  Shewanella oneidensis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap