1ECM


Conserved Protein Domain Family
CM_P_1

?
TIGR01797: CM_P_1 
Click on image for an interactive view with Cn3D
chorismate mutase domain of proteobacterial P-protein, clade 1
This model represents the chorismate mutase domain of the gamma and beta proteobacterial "P-protein" which contains an N-terminal chorismate mutase domain and a C-terminal prephenate dehydratase domain. [Amino acid biosynthesis, Aromatic amino acid family]
Statistics
?
PSSM-Id: 130856
View PSSM: TIGR01797
Aligned: 4 rows
Threshold Bit Score: 118.381
Threshold Setting Gi: 1311033
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1ECM_A   7 LLALREKISALDEKLLALLAERRELAVEVGKAKLLSHRPVRDIDRERDLLERLITLG--KAHHLDAHYITRLFQLIIEDS 84  Escherichia coli
P07022   7 LLALREKISALDEKLLALLAERRELAVEVGKAKLLSHRPVRDIDRERDLLERLITLG--KAHHLDAHYITRLFQLIIEDS 84  Escherichia coli
P57472   7 LLIFRDEINNIDKKIVKLLAERKNLVFKIAQSKIENNQAIRDIEREKKMLQKLIFLG--KKYNLKSEYITQLFQLIIEES 84  Buchnera aphidicola s...
P43900   5 LSDIRQQITQIDRSLLKLLSERHRLAFDVVRSKEISQKSLRDVEREQQLLQELVQFAenENYQLEAQYITSIFQKIIEDS 84  Haemophilus influenza...
1ECM_A  85 VLTQQ 89  Escherichia coli
P07022  85 VLTQQ 89  Escherichia coli
P57472  85 VATQK 89  Buchnera aphidicola str. APS (Acyrthosiphon pisum)
P43900  85 VLTQQ 89  Haemophilus influenzae Rd KW20
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap