Conserved Protein Domain Family
CM_mono_aroH

?
TIGR01796: CM_mono_aroH 
monofunctional chorismate mutase, gram positive type, clade 1
This model represents a family of monofunctional (non-fused) chorismate mutases from gram positive bacteria (Firmicutes) and cyanobacteria. Trusted members of the family are found in operons with other enzymes of the chorismate pathways, both up- and downstream of CM (Listeria, Bacillus, Oceanobacillus) or are the sole CM in the genome where the other members of the chorismate pathways are found elsewhere in the genome (Nostoc, Thermosynechococcus). [Amino acid biosynthesis, Aromatic amino acid family]
Statistics
?
PSSM-Id: 130855
View PSSM: TIGR01796
Aligned: 4 rows
Threshold Bit Score: 174.222
Threshold Setting Gi: 490074887
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_009924600   1 MRAIRGATTIETNIPEEIYAATKELFEEILTQNEVTnSEQLTSVIITVTEDISAAFPAKAVRETPGFELVPVMGMQEIPV 80  Listeria monocy...
WP_010897820   3 VRGVRGATTVKANQEKEILDATEGLMRTICEENEID-PENVAQVILTVTEDLTATFPAKALRRLAGWTHVPVMCAQEIPV 81  Bacillus halodu...
WP_010998152   5 LRAIRGATTVSGNSVEAIREAVSELLDELERRNQLQ-PQDMISVTFSVTRDLDAIFPAAIARPRPGWDNVAMLDVQQMHV 83  Nostoc sp. PCC ...
WP_003977062   3 VRAVRGAVQLERDEAGHMGEQVAALLTALMERNGLT-ADDLISLWFTATPDLHSDFPAAAARGL-GITDVPLICAQELDV 80  Streptomyces
WP_009924600  81 PNSLPMCIRFMVFTDLHKPLGAINHVYLRGAKVLRPDL 118 Listeria monocytogenes
WP_010897820  82 PNGLEKCIRVMITLNTTKAQSEIHHVYLNEAVKLRPDL 119 Bacillus halodurans
WP_010998152  84 EGSLQRCIRFLIHAY-QPTSVPVHHIYLREARKLRPDW 120 Nostoc sp. PCC 7120
WP_003977062  81 EGAMPRVVRVLAHIESERPRTGIAHVYLGAAAALRKDI 118 Streptomyces
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap