Conserved Protein Domain Family

TIGR01796: CM_mono_aroH 
monofunctional chorismate mutase, gram positive type, clade 1
This model represents a family of monofunctional (non-fused) chorismate mutases from gram positive bacteria (Firmicutes) and cyanobacteria. Trusted members of the family are found in operons with other enzymes of the chorismate pathways, both up- and downstream of CM (Listeria, Bacillus, Oceanobacillus) or are the sole CM in the genome where the other members of the chorismate pathways are found elsewhere in the genome (Nostoc, Thermosynechococcus). [Amino acid biosynthesis, Aromatic amino acid family]
PSSM-Id: 130855
Aligned: 4 rows
Threshold Bit Score: 174.222
Threshold Setting Gi: 490074887
Created: 8-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
WP_009924600  81 PNSLPMCIRFMVFTDLHKPLGAINHVYLRGAKVLRPDL 118 Listeria monocytogenes
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap