Conserved Protein Domain Family
CM_mono_cladeE

?
TIGR01795: CM_mono_cladeE 
monofunctional chorismate mutase, alpha proteobacterial type
This model represents a small clade of monofunctional (non-fused) chorismate mutases spanning alpha proteobacteria and two actinobacter gram positive species. The alpha proteobacterial members are trusted because the pathways of CM are evident and there is only one plausible CM in the genome. In S. coelicolor, however, there is another aparrent monofunctional CM. [Amino acid biosynthesis, Aromatic amino acid family]
Statistics
?
PSSM-Id: 130854
View PSSM: TIGR01795
Aligned: 3 rows
Threshold Bit Score: 146.253
Threshold Setting Gi: 642987083
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
nestle:BL0397  27 AVARIKALRQTIDNIDSAVIALLAERFKATSQVGVLKANAGFAPEDTKREDYQIERLHRIAIDAGLDPEIAEMYREFVVT 106 Bifidobacteriu...
WP_003976797   15 VREELARLRDSIDNIDAAVVHMLAERFKCTQQVGHLKARHQLPPADPAREAQQIARLRTLAESAKLDPAFAEKFLNFIVA 94  Streptomyces
WP_025200146   11 IPAELLALRASIDNIDAALIHMLAERFRCTKAVGVLKAERGLAPADPAREKRQVARLRALAADANLDPDFAEKFLNFIVK 90  Brucella inopi...
nestle:BL0397 107 EAKKRHQRIADAGG 120 Bifidobacterium longum NCC2705
WP_003976797   95 EVIHHHERIAESNA 108 Streptomyces
WP_025200146   91 EVIRHHEHTAANHG 104 Brucella inopinata
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap