Conserved Protein Domain Family
cit_synth_euk

?
TIGR01793: cit_synth_euk 
citrate (Si)-synthase, eukaryotic
This model includes both mitochondrial and peroxisomal forms of citrate synthase. Citrate synthase is the entry point to the TCA cycle from acetyl-CoA. Peroxisomal forms, such as SP:P08679 from yeast (recognized by the C-terminal targeting motif SKL) act in the glyoxylate cycle. Eukaryotic homologs excluded by the high trusted cutoff of this model include a Tetrahymena thermophila citrate synthase that doubles as a filament protein, a putative citrate synthase from Plasmodium falciparum (no TCA cycle), and a methylcitrate synthase from Aspergillus nidulans.
Statistics
?
PSSM-Id: 130853
View PSSM: TIGR01793
Aligned: 3 rows
Threshold Bit Score: 851.494
Threshold Setting Gi: 8928010
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O00098  39 TKSLKETFADKLPGELEKVKKLRKEHGNKVIGELTLDQAYGGARGVKCLVWEGSVLDSEEGIRFRGLTIPECQKLLPKAP 118 Aspergillus nidulans ...
P34575  32 STNLKEVLSKKIPAHNAKVKSFRTEHGSTVVQNVNIDMIYGGMRSMKGMVTETSVLDPEEGIRFRGYSIPECQKLLPKAK 111 Caenorhabditis elegans
O80433  38 DLDLRSQLKELIPEQQERIKKLKAEHGKVQLGNITVDMVLGGMRGMTGLLWETSLLDPEEGIRFRGLSIPECQKLLPGAK 117 carrot
O00098 119 GGEEPLPEGLFWLLLTGEVPSEQQVRDLSAEWAARSDLPKFIEELIDRCPSTLHPMAQFSLAVTALEHESAFAKAYAKGI 198 Aspergillus nidulans ...
P34575 112 GGEEPLPEAIWWLLCTGDVPSEAQTAAITKEWNARADLPTHVVRMLDNFPDNLHPMAQFIAAIAALNNESKFAGAYARGV 191 Caenorhabditis elegans
O80433 118 PGGEPLPEGLLWLLLTGKVPTKEQVDALSAELRSRAAVPEHVYKTIDALPVTAHPMTQFATGVMALQVQSEFQKAYEKGI 197 carrot
O00098 199 NKKEYWHYTFEDSMDLIAKLPTIAAKIYRNVFKDGKV-APIQKDKDYSYNLANQLGFaDNKDFVELMRLYLTIHSDHEGG 277 Aspergillus nidulans ...
P34575 192 AKASYWEYAYEDSMDLLAKLPTVAAIIYRNLYRDGSAvSVIDPKKDWSANFSSMLGY-DDPLFAELMRLYLVIHSDHEGG 270 Caenorhabditis elegans
O80433 198 HKTKYWEPTYEDSITLIAQLPVVAAYIYRRMYKNGQS-ISTDDSLDYGANFAHMLGY-DSPSMQELMRLYVTIHTDHEGG 275 carrot
O00098 278 NVSAHTTHLVGSALSSPMLSLAAGLNGLAGPLHGLANQEVLNWLTEMKKVVGNdLSDQSIKDYLWSTLNAGRVVPGYGHA 357 Aspergillus nidulans ...
P34575 271 NVSAHTSHLVGSALSDPYLSFSAAMAGLAGPLHGLANQEVLVFLNKIVGEIGFnYTEEQLKEWVWKHLKSGQVVPGYGHA 350 Caenorhabditis elegans
O80433 276 NVSAHTGHLVASALSDPYLSFAAALNGLAGPLHGLANQEVLLWIKSVVSECGEnVTKEQLKDYIWKTLNSGKVVPGYGHG 355 carrot
O00098 358 VLRKTDPRYTSQREFALRKLPDDPMFKLVSQVYKIAPGVLTEHGKTKNPYPNVDAHSGVLLQYYGLTEANYYTVLFGVSR 437 Aspergillus nidulans ...
P34575 351 VLRKTDPRYECQREFALKHLPNDDLFKLVSTLYKITPGILLEQGKAKNPWPNVDSHSGVLLQYFGMTEMSFYTVLFGVSR 430 Caenorhabditis elegans
O80433 356 VLRNTDPRYICQREFALKHLPDDPLFQLVSNLFEVVPPILTELGKVKNPWPNVDAHSGVLLNHYGLTEARYYTVLFGVSR 435 carrot
O00098 438 ALGVLPQLIIDRAFGAPIERPKSFSTEAY 466 Aspergillus nidulans FGSC A4
P34575 431 ALGCLSQLIWARGMGLPLERPKSHSTDGL 459 Caenorhabditis elegans
O80433 436 AIGICSQLVWDRALGLPLERPKSVTMEWL 464 carrot
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap