Conserved Protein Domain Family
CM_archaeal

?
TIGR01791: CM_archaeal 
chorismate mutase, archaeal type
This model represents a clade of archaeal chorismate mutases. Chorismate mutase catalyzes the conversion of chorismate into prephenate which is subsequently converted into either phenylalanine or tyrosine. In Sulfolobus this gene is found as a fusion with prephenate dehydrogenase (although the non-TIGR annotation contains a typographical error indicating it as a dehydratase OMNI|NTL02SS0274) which is the next enzyme in the tyrosine biosynthesis pathway. The Archaeoglobus gene contains an N-terminal prephenate dehydrogenase domain and a C-terminal prephenate dehydratase domain followed by a regulatory amino acid-binding ACT domain. The Thermoplasma volcanium gene is adjacent to prephenate dehydratase. [Amino acid biosynthesis, Aromatic amino acid family]
Statistics
?
PSSM-Id: 130851
View PSSM: TIGR01791
Aligned: 6 rows
Threshold Bit Score: 74.771
Threshold Setting Gi: 499178899
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAM04793       4 LEAVRKEIEEIDREILSLIDKRVNLAERVLESKRINGTSINDRKQNEvviNRALNTATELNLDVGSIKEIFEILIRMSIE 83  Methanosarcina ...
O30012       266 IEELRGLIKSIDSLILRLIERRIDAARQIARIKMERGEPIELKDVEE---EKLWEVMSKTTLNPVKLKEIFEGIMSLAKE 342 Archaeoglobus f...
WP_010917607   7 IEDLRQDLLENTKSILALLEKRREITRKIGKIKHNNGLPIRDAERELrvkSELC--SNNPLLNVLFEASIFDQQSLNSAM 84  Thermoplasma vo...
WP_011019977   4 LEELRREIDRIDECLLDAVIERLKVAREIGRVKAQEGLPLTDEEREKelrERWRKRFKTEGLDPALADIVLASILKVSKE 83  Methanopyrus ka...
WP_010876439  10 LRRSRQKIDGIDRDILDLITSRIALAREIAEAKEVLGMEILDPERELqiiERTRKIARENGIDENKLTELMKILMDLSKT 89  Methanothermoba...
WP_010980354   5 IDELRKEIEAIDKQILELLSRRLKISAKIGEIKSRIGKDVTDEKREQkvrEYWYNYARNLGIPDSMVESILPILFSYSKM 84  Sulfolobus toko...
AAM04793      84 RQN 86  Methanosarcina acetivorans C2A
O30012       343 EEY 345 Archaeoglobus fulgidus
WP_010917607  85 DLR 87  Thermoplasma volcanium
WP_011019977  84 VQR 86  Methanopyrus kandleri
WP_010876439  90 EQK 92  Methanothermobacter thermautotrophicus
WP_010980354  85 VQI 87  Sulfolobus tokodaii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap