Conserved Protein Domain Family
carotene-cycl

?
TIGR01790: carotene-cycl 
lycopene cyclase family protein
This family includes lycopene beta and epsilion cyclases (which form beta and delta carotene, respectively) from bacteria and plants as well as the plant capsanthin/capsorubin and neoxanthin cyclases which appear to have evolved from the plant lycopene cyclases. The plant lycopene epsilon cyclases also transform neurosporene to alpha zeacarotene.
Statistics
?
PSSM-Id: 130850
View PSSM: TIGR01790
Aligned: 7 rows
Threshold Bit Score: 435.707
Threshold Setting Gi: 11135921
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O65837   107 DLVVIGCGPAGLALAAESA--KLGLNVGLVG--PD-LPFTNNYGVWEDEFKDLG---LQACIEHVWRDTIVYLDDdEPIL 178 tomato
Q55276     3 DALVIGSGPAGLAIAAELA--QRGLKVQGLSpvDPfHPWENTYGIWGPELDSLG---LEHLFGHRWSNCVSYFGE-APVQ 76  Synechococcus elong...
Q9RW68    10 DVLVIGGGPSGTALSAELA--ARGLDVQQLAphPP-RPFPATYGAWLGDLPTWA---RG-CAEQVWTDVRAYTGP-QPTS 81  Deinococcus radiodu...
Q43503    85 DLAVVGGGPAGLAVAQQVS--EAGLSVCSIDpnPK-LIWPNNYGVWVDEFEAMD---LLDCLDATWSGAAVYIDDnTAKD 158 tomato
AAA21262   6 DLILVGAGLANGLIALRLQqqQPDMRILLIEaaPQ-AGGNHTWSFHDADLTESQhrwVAPLVVYHWPD-YQVRFPtRRRK 83  Pantoea agglomerans
AAF78200   6 DVIVIGGGLAGCLIALRLTdaRPDLRVVIIEgsAS-IAGNHTWSFFGTDISSDQhawLGRLVGHRWPG-YEVRFAeHAIR 83  Bradyrhizobium sp. ...
BAA20275  16 DCAIVGGGLAGGLIALALQraRPEFRIRVIEagRT-IGGNHRWSWFDSDLSDAGralLADFRQTDWEGGYEVRFPkYRRK 94  Erythrobacter longus
O65837   179 IGRAYGRVSRHFLHEELLKRCVEAGVLYLNSKVDRIVEAtNGQSLVECEGDVVIPCRFVTVASGAASgkFLQYELGSPRV 258 tomato
Q55276    77 HQYNYGLFDRAQLQQHWLRQCEQGGLQWQLGKAAAIAHD-SHHSCVTTAAGQELQARLVVDTTGHQA--AFIQRPHSDAI 153 Synechococcus elong...
Q9RW68    82 LGQPYALLDNAALLRTLRGLAD---WTWVEGAALHAERS-GAGWTVYGAGGERWQTRLVVDASGHGA--LVSPVRFPGGA 155 Deinococcus radiodu...
Q43503   159 LHRPYGRVNRKQLKSKMMQKCIMNGVKFHQAKVIKVIHE-ESKSMLICNDGITIQATVVLDATGFSRs-LVQYDK-PYNP 235 tomato
AAA21262  84 LNSGYFSVTSQRFAEVLQQKFGQH--LWISRAVAEVHADaVRLN-----NGQVISASAVIDGRGYTP-------NSALNV 149 Pantoea agglomerans
AAF78200  84 LSTAYLSMTSTRLRAEVEQRFPER--ILRDATAISATADhVVLE-----GGRTLRAPCVIDARGGRP-------VPGLAL 149 Bradyrhizobium sp. ...
BAA20275  95 LKTAYRSMASTDFHEGLLRALPEGs-VILGRKAVGLDARgVDLAPSQYGPATRINARSVIDCRSFKP-------SAHLKG 166 Erythrobacter longus
O65837   259 SVQTAYGVEVEVDNNPFDPSLMVFMDYRDYLRhdAQSLEAKY---PTFLYAMPMSPTRVFFEETCLASKDAMPFDLLKKK 335 tomato
Q55276   154 AYQAAYGIIGQFSQPPIEPHQFVLMDYRSDHL--SPEERQLP---PTFLYAMDLGNDVYFVEETSLAACPAIPYDRLKQR 228 Synechococcus elong...
Q9RW68   156 ALQTAYGVVARFRRPPVTPGSMVWMDYRTP----APELKRGE---ATFLYAMHLGGDRYFVEETSLIARPAPTRAELRRR 228 Deinococcus radiodu...
Q43503   236 GYQVAYGILAEVEEHPFDVNKMVFMDWRDSHLknNTDLKERNsriPTFLYAMPFSSNRIFLEETSLVARPGLRIDDIQER 315 tomato
AAA21262 150 GFQAFIGQEWRLS-KPHGLSSPIIMDATVDQQn------GYR-----FVYSLPLSATELLIEDTHYIDNATLEPERARQN 217 Pantoea agglomerans
AAF78200 150 GFQKFLGLEVRLA-APHGLDVPIVMDATVAQSd------GYR-----FVYTLPLDPQRLLIEDTYYSDGGELPEQVLHQR 217 Bradyrhizobium sp. ...
BAA20275 167 GWQVFLGRHMRLQ-EPHGVENPVIMDATVDQLapHGNGGSYR-----FVYVLPLGSHDVFIEDTYYADDPLLDRNALSGR 240 Erythrobacter longus
O65837   336 LMLRLNTLGVRIKEIYEEEWSYIPVGGSLPN----TEQK---TLAFGAAASMVHPATGYSVVRSLSEAPKCASVLANILR 408 tomato
Q55276   229 LYQRLATRGVTVQVIQHEEYCLFPMNLPLPD----LTQS---VVGFGGAASMVHPASGYMVGALLRRAPDLANAIAAGLN 301 Synechococcus elong...
Q9RW68   229 LLARLSAQGTPPHATESEEWVAFPMNAQAP-----APGG---VLAYGAAAGRVHPVSGFQVAGALSDAPGVATAIATALC 300 Deinococcus radiodu...
Q43503   316 MVARLNHLGIKVKSIEEDEHCLIPMGGPLPV----LPQR---VVGIGGTAGMVHPSTGYMVARTLAAAPVVANAIIQYLG 388 tomato
AAA21262 218 IRDYAAQQDWQLQTLLREEQGALPITLTGDStafwQQQP---LACSGLRAGLFHPTTGYSLPLAVALADRLSALD----V 290 Pantoea agglomerans
AAF78200 218 IARYALAKGWQIAEIIRAEQGVLPVILAGDPsglvSKPDs--PPRVGLAALLVHPTTGYSLPDAVRVADLLTARLAQRGA 295 Bradyrhizobium sp. ...
BAA20275 241 IDQYARANGWENGTPVHHEAGVLPVLTGGDFsayqDEVRipgVAIAGARGGFTHPLTSYTMCVAVENALAMAEQP----D 316 Erythrobacter longus
O65837   409 QHYsknmltsssipSISTQAWNTLWPQERKRQRSFFLFGLALILQLDIEGIRSFFRAFFRVPKWMWQGFLGSSLSSADLM 488 tomato
Q55276   302 ASSslt------taELATQAWRGLWPTEKIRKHYIYQFGLEKLMRFSEAQLNHHFQTFFGLPKEQWYGFLTNTLSLPELI 375 Synechococcus elong...
Q9RW68   301 QGK-----------DAAAAGWAALWSPERRAAREVHLLGVGALLGLERAELPHFFGTFFGLPREQWARFLHPDTDAGTLA 369 Deinococcus radiodu...
Q43503   389 SERshs------gnELSTAVWKDLWPIERRRQREFFCFGMDILLKLDLPATRRFFDAFFDLEPRYWHGFLSSRLFLPELI 462 tomato
AAA21262 291 FTS-----------SSIHQAITHFAHERWQQQRFFRMLNRMLFLAGPADSRWRVMQRFYGLPEDLISRFYAGKLTLTDRL 359 Pantoea agglomerans
AAF78200 296 LSS-----------ADARETIDGYGRTIWRRRGYYRFLNRMLFKAAEPSERHRILARFYGLDQALIERFYAARIQPQDKL 364 Bradyrhizobium sp. ...
BAA20275 317 LSG-----------EQLAAFFDSRARRHWSKTGYYRLLARFLFFAAKPEKRVKVFQRFYGLREGLIERFYAARSNTFDKV 385 Erythrobacter longus
O65837   489 LFAFYMFIIAPNDMRKGL 506 tomato
Q55276   376 QAMLRLFAQAPNDVRWGL 393 Synechococcus elongatus PCC 7942
Q9RW68   370 RTMLRVFAQTGGRVRLPL 387 Deinococcus radiodurans R1
Q43503   463 VFGLSLFSHASNTSRFEI 480 tomato
AAA21262 360 RILS---GKPPVPVLAAL 374 Pantoea agglomerans
AAF78200 365 RVFMHMLMKPPIPISSAL 382 Bradyrhizobium sp. ORS 278
BAA20275 386 RVLW---GEPPVAIHSAI 400 Erythrobacter longus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap