Conserved Protein Domain Family
lycopene_cycl

?
TIGR01789: lycopene_cycl 
lycopene cyclase
This model represents a family of bacterial lycopene cyclases catalyzing the transformation of lycopene to carotene. These enzymes are found in a limited spectrum of alpha and gamma proteobacteria as well as Flavobacterium.
Statistics
?
PSSM-Id: 130849
View PSSM: TIGR01789
Aligned: 3 rows
Threshold Bit Score: 621.885
Threshold Setting Gi: 2130969
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAA20275  16 DCAIVGGGLAGGLIALALQRARPEFRIRVIEAGRTIGGNHRWSWFDSDLSDAGRALLADFRQTDWEGgYEVRFPKYRRKL 95  Erythrobacter longus
AAA21262   6 DLILVGAGLANGLIALRLQQQQPDMRILLIEAAPQAGGNHTWSFHDADLTESQHRWVAPLVVYHWPD-YQVRFPTRRRKL 84  Pantoea agglomerans
AAF78200   6 DVIVIGGGLAGCLIALRLTDARPDLRVVIIEGSASIAGNHTWSFFGTDISSDQHAWLGRLVGHRWPG-YEVRFAEHAIRL 84  Bradyrhizobium sp. ...
BAA20275  96 KTAYRSMASTDFHEGLLRALPEGsVILGRKAVGLDARGVDLApsqygPATRINARSVIDCRSFKPSAHLKGGWQVFLGRH 175 Erythrobacter longus
AAA21262  85 NSGYFSVTSQRFAEVLQQKFGQH-LWISRAVAEVHADAVRLN-----NGQVISASAVIDGRGYTPNSALNVGFQAFIGQE 158 Pantoea agglomerans
AAF78200  85 STAYLSMTSTRLRAEVEQRFPER-ILRDATAISATADHVVLE-----GGRTLRAPCVIDARGGRPVPGLALGFQKFLGLE 158 Bradyrhizobium sp. ...
BAA20275 176 MRLQEPHGVENPVIMDATVDQLAphgnggSYRFVYVLPLGSHDVFIEDTYYADDPLLDRNALSGRIDQYARANGWENGTP 255 Erythrobacter longus
AAA21262 159 WRLSKPHGLSSPIIMDATVDQQN------GYRFVYSLPLSATELLIEDTHYIDNATLEPERARQNIRDYAAQQDWQLQTL 232 Pantoea agglomerans
AAF78200 159 VRLAAPHGLDVPIVMDATVAQSD------GYRFVYTLPLDPQRLLIEDTYYSDGGELPEQVLHQRIARYALAKGWQIAEI 232 Bradyrhizobium sp. ...
BAA20275 256 VHHEAGVLPVLTGGDFSAYQDEVRipgVAIAGARGGFTHPLTSYTMCVAVENALAMAEQP----DLSGEQLAAFFDSRAR 331 Erythrobacter longus
AAA21262 233 LREEQGALPITLTGDSTAFWQQQP---LACSGLRAGLFHPTTGYSLPLAVALADRLSALD----VFTSSSIHQAITHFAH 305 Pantoea agglomerans
AAF78200 233 IRAEQGVLPVILAGDPSGLVSKPDs--PPRVGLAALLVHPTTGYSLPDAVRVADLLTARLaqrgALSSADARETIDGYGR 310 Bradyrhizobium sp. ...
BAA20275 332 RHWSKTGYYRLLARFLFFAAKPEKRVKVFQRFYGLREGLIERFYAARSNTFDKVRVLW---GEPPVAIHSAI 400 Erythrobacter longus
AAA21262 306 ERWQQQRFFRMLNRMLFLAGPADSRWRVMQRFYGLPEDLISRFYAGKLTLTDRLRILS---GKPPVPVLAAL 374 Pantoea agglomerans
AAF78200 311 TIWRRRGYYRFLNRMLFKAAEPSERHRILARFYGLDQALIERFYAARIQPQDKLRVFMhmlMKPPIPISSAL 382 Bradyrhizobium sp. ORS 278
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap