1XEY


Conserved Protein Domain Family
Glu-decarb-GAD

?
TIGR01788: Glu-decarb-GAD 
Click on image for an interactive view with Cn3D
glutamate decarboxylase
This model represents the pyridoxal phosphate-dependent glutamate (alpha) decarboxylase found in bacteria (low and hi-GC gram positive, proteobacteria and cyanobacteria), plants, fungi and at least one archaon (Methanosarcina). The product of the enzyme is gamma-aminobutyrate (GABA).
Statistics
?
PSSM-Id: 130848
View PSSM: TIGR01788
Aligned: 9 rows
Threshold Bit Score: 716.107
Threshold Setting Gi: 2494176
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1XEY_A        16 SRFGAK----AIST----IAES-KRFPLHEMRDDVAFQIINDELYLDGNARQNLATFCQTWDDENVHKLMDLSINKNWID 86  Escherichia coli
P80063        16 SRFGAK----AIST----IAES-KRFPLHEMRDDVAFQIINDELYLDGNARQNLATFCQTWDDENVHKLMDLSINKNWID 86  Escherichia coli
CAD40878      15 STFASR----YVRT----ALPR-FRMPEKSIPKDAAYQIINDELMLDGNPRLNLASFVTTWMEPECDKLMMAAINKNYVD 85  Oryza sativa (j...
Q9EYW9        14 PVFGSS----AEDR----DIPK-YTLGKEPLEPRIAYRLVKDELLDEGSARQNLATFCQTYMEDEATKLMSETLEKNAID 84  Listeria monocy...
WP_010871692  20 PTYAAR----GLAN----SVSK-YEMPETEMLPAIAYNLIHDELGLDGNSRLNLATFVTTWMEPEARQLMADTFDKNMID 90  Synechocystis s...
Q04792        41 GHQGSNnmrdTSSQ----GMANkYSVPKKGLPADLSYQLIHNELTLDGNPHLNLASFVNTFTTDQARKLIDENLTKNLAD 116 Saccharomyces c...
CAB91726      42 SVYGSK----FAAA----DLPR-HEMPDEEMPKEVAYRMIKDELSLDGNPLLNLASFVTTYMEEEAEKLMTESLPKNFID 112 Neurospora crassa
WP_003913477  83 PAYTGR----MFTA----PVPA-LRMPDESMDPEAAYRFIHDELMLDGSSRLNLATFVTTWMDPEAEKLMAETFDKNMID 153 Mycobacterium t...
WP_011021944  20 GAYSAR----YVPKtkekGIPK-YEFPEEGMSPRAAYQLVHDEQSLDGNPFLNLASFVNTWMEPEADKLVMENISKNIID 94  Methanosarcina ...
1XEY_A        87 KEEYPQSA-AIDLRCVNMVADLWHAPapKNGQ---A---VGTNTIGSSEACMLGGMAMKWRWRKRMEAAGKPTD--KPNL 157 Escherichia coli
P80063        87 KEEYPQSA-AIDLRCVNMVADLWHAPapKNGQ---A---VGTNTIGSSEACMLGGMAMKWRWRKRMEAAGKPTD--KPNL 157 Escherichia coli
CAD40878      86 MDEYPVTT-ELQNRCVNMIAHLFNAPi-GDDEt--A---VGVGTVGSSEAIMLAGLAFKRKWQNRMKAEGKPHD--KPNI 156 Oryza sativa (j...
Q9EYW9        85 KSEYPRTA-ELENRCVNIIADLWHAP--KDQK---F---MGTSTIGSSEACMLGGMAMKFAWRKRAEKLGLDIYakKPNL 155 Listeria monocy...
WP_010871692  91 KDEYPQTA-EIELRCVNILSRLWNAPa-S-AE---A---TGCSTIGSSEAAMLGGMAMKWKWRQRRQAAGKPGD--RPNL 159 Synechocystis s...
Q04792       117 NDEYPQLI-ELTQRCISMLAQLWHAN--PDEE---P---IGCATTGSSEAIMLGGLAMKKRWEHRMKNAGKDAS--KPNI 185 Saccharomyces c...
CAB91726     113 YEEYPQTA-DIQNRCVSMIGRLFNAPv-KDAE---AssaVGTSSVGSSEAIMLGVLAMKKRWKNKRIAEGKPAD--KPNL 185 Neurospora crassa
WP_003913477 154 KDEYPATA-AIEARCVSMVADLFHAEglRDHDptsA---TGVSTIGSSEAVMLGGLALKWRWRQR---VGSWKGr-MPNL 225 Mycobacterium t...
WP_011021944  95 IFEYPQTSrVIHHNMVNMLGRLFNGHh-TD-----F---VGTSTAGSSEAIMLGLLAHKWSWKK----SGRGTD--KPNI 159 Methanosarcina ...
1XEY_A       158 VCGP-VQICWHKFARYWDVELREIPMRP-GQLFMDPKRMIEACDENTIGVVPTFGVTYTGNYEFPQPLHDALDKFQADT- 234 Escherichia coli
P80063       158 VCGP-VQICWHKFARYWDVELREIPMRP-GQLFMDPKRMIEACDENTIGVVPTFGVTYTGNYEFPQPLHDALDKFQADT- 234 Escherichia coli
CAD40878     157 VTGAnVQVCWEKFARYFEVELKEVKLTQ-GYYVMNPEKAVEMVDENTICVAAILGSTLNGEFEDVKMLNDLLTAKNAET- 234 Oryza sativa (j...
Q9EYW9       156 VISSgYQVCWEKFCVYWDIDMRVVPMDK-EHMQLNTDQVLDYVDEYTIGVVGILGITYTGRYDDIYALNEKLEEYNSKT- 233 Listeria monocy...
WP_010871692 160 VMGInVQVCWEKFCRYWEVEPRFVPMEG-DRYHISPEEAVKLIDENTIGVIGILGSTFDGSYEPIEALNDALETLNQRT- 237 Synechocystis s...
Q04792       186 IMSSaCQVALEKFTRYFEVECRLVPVSHrSHHMLDPESLWDYVDENTIGCFVILGTTYTGHLENVEKVADVLSQIEAKHp 265 Saccharomyces c...
CAB91726     186 IMSSaVQVCWEKATRYFEVEEKFVYCTP-DRYVIDPKETVDLVDENTIGICCILGTTYTGEYEDVKAVNDLLVER----- 259 Neurospora crassa
WP_003913477 226 VMGSnVQVVWEKFCRYFDVEPRYLPMER-GRYVITPEQVLAAVDENTIGVVAILGTTYTGELEPIAEICAALDKLAAGG- 303 Mycobacterium t...
WP_011021944 160 IFGNdAHVCWDKFARYFDVDTRKVPIDK-DRRTITAEAVAERIDENTICVGCVLGTTFTGEIDPVKDINDLLLEYKEEK- 237 Methanosarcina ...
1XEY_A       235 ---GIDIDMHIDAASGGFLAPF--------VAPDIVWDFRLPRVKSISASGHKFGLAPLGCGWVIWRDEEALPQELVFNV 303 Escherichia coli
P80063       235 ---GIDIDMHIDAASGGFLAPF--------VAPDIVWDFRLPRVKSISASGHKFGLAPLGCGWVIWRDEEALPQELVFNV 303 Escherichia coli
CAD40878     235 ---GWNTPIHVDAASGGFIAPF--------IYPELEWDFRLPLVKSINVSGHKYGLVYAGVGWVIWRNKEDLPDELIFHI 303 Oryza sativa (j...
Q9EYW9       234 ---DYKVYIHVDAASGGFFTPF--------VEPDIIWDFRLKNVISINTSGHKYGLVYPGIGWVLWKDESYLPEELIFKV 302 Listeria monocy...
WP_010871692 238 ---GWQVPLHIDAASGGFIAPF--------LDPDLRWDFRLPWVKSINTSGHKYGLVYPGVGWIIWRDKEELPEELIFHC 306 Synechocystis s...
Q04792       266 dwsNTDIPIHADGASGGFIIPFgfekehmkAYGMERWGFNHPRVVSMNTSGHKFGLTTPGLGWVLWRDESLLADELRFKL 345 Saccharomyces c...
CAB91726     260 ---GLDTPIHVDAASGGFVAPF--------VVPDLEWDFRLKNVVSINVSGHKYGLVYPGVGWVVWRSAEYLPQELVFNI 328 Neurospora crassa
WP_003913477 304 ---GVDVPVHVDAASGGFVVPF--------LHPDLVWDFRLPRVVSINVSGHKYGLTYPGVGFVVWRGPEHLPEDLVFRV 372 Mycobacterium t...
WP_011021944 238 ---GWDIPIHIDAASGGFILPF--------TEPDFEWDFRLERVKSINVSGHKYGLTYPGLGWLIFRNKNALPEDLIFHV 306 Methanosarcina ...
1XEY_A       304 DYLGGQIGTFAINFSRPAGQVIAQYYEFLRLGREGYTKVQNASYQVAAYLADEIAKL----GPYEFICT--Grp------ 371 Escherichia coli
P80063       304 DYLGGQIGTFAINFSRPAGQVIAQYYEFLRLGREGYTKVQNASYQVAAYLADEIAKL----GPYEFICT--Grp------ 371 Escherichia coli
CAD40878     304 NYLGADQPTFTLNFSKGSNQIIAQYYQLIRLGFEGYKDIMQNCRDNATVLREGIEKT----GHFDVVSK--D-------- 369 Oryza sativa (j...
Q9EYW9       303 SYLGGEMPTMQINFSRSASHIIGQYYNFLRYGFEGYRTIHQKTSDVAQYLAHAVEQT----GYFDIFND--G-------- 368 Listeria monocy...
WP_010871692 307 NYLGGDLPNFALNFSRPGNQVVAQYYNFLRLGKEGYRKIQQTCRDTALYLSGKIAQL----GPFELLTD--G-------- 372 Synechocystis s...
Q04792       346 KYLGGVEETFGLNFSRPGFQVVHQYFNFVSLGHSGYRTQFQNSLFVARAFSFELLNSsklpGCFEIVSS--Ihesiends 423 Saccharomyces c...
CAB91726     329 NYLGADQASFTLNFSKGASQVIGQYYQLIRLGKHGYRAIMSNLTRTADYLAESLAAL----G-FIIMSQksG-------- 395 Neurospora crassa
WP_003913477 373 NYLGGDMPTFTLNFSRPGNQVVGQYYNFLRLGRDGYTKVMQALSHTARWLGDQLREV----DHCEVISD--G-------- 438 Mycobacterium t...
WP_011021944 307 NYLGEMEDSYTLNFSGGSAMVAAQYYNFLRFGRAGYTGIMKKILAVSQDLAEKVDRL----GRFEMLNK--G-------- 372 Methanosarcina ...
1XEY_A       372 ---------------dEGIPAVCFKLKDG--ED---PGYTLYDLSERLRLRGWQVPAFTLGGEAT---DIVVMRIMCRRG 428 Escherichia coli
P80063       372 ---------------dEGIPAVCFKLKDG--ED---PGYTLYDLSERLRLRGWQVPAFTLGGEAT---DIVVMRIMCRRG 428 Escherichia coli
CAD40878     370 ----------------SGVPLVAFSLKDS-------SRYTVFEVAESLRRFGWIVPAYTMPADAE---HVAVMRVVIRED 423 Oryza sativa (j...
Q9EYW9       369 ----------------SHLPIVCYKLKDD--AN---VNWTLYDLADRLQMRGWQVPAYPLPKSLE---NIIIQRYVCRAD 424 Listeria monocy...
WP_010871692 373 ----------------GDIPVFAWRLKDEvlAN---TCYTLYDMADKLRERGWLVPAYRMPKNRE---DLVVQRIVVKEG 430 Synechocystis s...
Q04792       424 apksvkdywehpqaykPGVPLVAFKLSKK--FHeeyPEVPQAILSSLLRGRGWIIPNYPLPKATDgsdEKEVLRVVFRSE 501 Saccharomyces c...
CAB91726     396 ----------------QGLPLVAFRLKED--PD---RTYDEFALAHQLRVRGWIVPAYTMAPKTE---GLKMLRIVVRED 451 Neurospora crassa
WP_003913477 439 ----------------SAIPVVSFRLAGD--R-----GYTEFDVSHELRTFGWQVPAYTMPDNAT---DVAVLRIVVREG 492 Mycobacterium t...
WP_011021944 373 ----------------ERLPIIAFRQKEK-------TGYSLLQLSHKLREKGWIVPAYCLPENAA---DIEIMRIVVREN 426 Methanosarcina ...
1XEY_A       429 FEMDFAELLLEDYKASLKYLS 449 Escherichia coli
P80063       429 FEMDFAELLLEDYKASLKYLS 449 Escherichia coli
CAD40878     424 FSRGLAERLITDLTKTVADMD 444 Oryza sativa (japonica cultivar-group)
Q9EYW9       425 LGFNMAEEFIQDFQASIQELN 445 Listeria monocytogenes EGD-e
WP_010871692 431 FSRDMADLLLADMERAIAYFA 451 Synechocystis sp. PCC 6803
Q04792       502 MKLDLAQLLIVDIESILTKLI 522 Saccharomyces cerevisiae S288c
CAB91726     452 FSRNRCDGLISDIRSCQGILE 472 Neurospora crassa
WP_003913477 493 LSADLARALHDDAVTALAALD 513 Mycobacterium tuberculosis
WP_011021944 427 LTPDMASIIVEDLEKACQFLE 447 Methanosarcina acetivorans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap