2DFD,2PWZ


Conserved Protein Domain Family
MDH_euk_gproteo

?
TIGR01772: MDH_euk_gproteo 
Click on image for an interactive view with Cn3D
malate dehydrogenase, NAD-dependent
This model represents the NAD-dependent malate dehydrogenase found in eukaryotes and certain gamma proteobacteria. The enzyme is involved in the citric acid cycle as well as the glyoxalate cycle. Several isoforms exidt in eukaryotes. In S. cereviseae, for example, there are cytoplasmic, mitochondrial and peroxisomal forms. Although malate dehydrogenases have in some cases been mistaken for lactate dehydrogenases due to the similarity of these two substrates and the apparent ease with which evolution can toggle these activities, critical residues have been identified which can discriminate between the two activities. At the time of the creation of this model no hits above the trusted cutoff contained critical residues typical of lactate dehydrogenases. [Energy metabolism, TCA cycle]
Statistics
?
PSSM-Id: 130833
View PSSM: TIGR01772
Aligned: 9 rows
Threshold Bit Score: 455.327
Threshold Setting Gi: 2506850
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2DFD_A    30 KVAVLGASGGIGQPLSLLLKNS-PLVS-----------RLTLYDIAH-TP-GVAADLSHIETKAAVKGYLGPEq------ 89  human
P06994     2 KVAVLGAAGGIGQALALLLKTQlPSGS-----------ELSLYDIAP-VTpGVAVDLSHIPTAVKIKGFSGED------- 62  Escherichia coli
P40926    26 KVAVLGASGGIGQPLSLLLKNS-PLVS-----------RLTLYDIAH-TP-GVAADLSHIETKAAVKGYLGPEq------ 85  human
P17505    19 KVTVLGAGGGIGQPLSLLLKLN-HKVT-----------DLRLYDLKG-AK-GVATDLSHIPTNSVVKGFTPEEpd----- 79  Saccharomyces cerev...
AAL90140  29 KVAVVGSVGGIGQPLSLLLKHN-PQIS-----------TLSLYDIKN-TT-GVGVDLSHINTRASVCPFEGKNg------ 88  fruit fly
CAB55506   3 NVCVVGAAGGIGQSLSLLLVRQlPYGS-----------TLSLFDVVG-AA-GVAADLSHVDNAGVQVKFAEGKighkrdp 69  Leishmania major
P32419     3 KVAILGASGGVGQPLSLLLKLS-PYVS-----------ELALYDIR--AAeGIGKDLSHINTNSSCVGYDKDS------- 61  Saccharomyces cerev...
P22133    15 KIAILGAAGGIGQSLSLLLKAQ-LQYQlkesnrsvthiHLALYDVNQeAInGVTADLSHIDTPISVSSHSPAGg------ 87  Saccharomyces cerev...
2PWZ_A     2 KVAVLGAAGGIGQALALLLKTQlPSGS-----------ELSLYDIAPvTP-GVAVDLSHIPTAVKIKGFSGED------- 62  Escherichia coli
2DFD_A    90 -LPDCLKGCDVVVIPAGVPRKPGMTRDDLFNTNATIVATLTAACAQHCPEAM--ICVIANPVNSTIPITAEVFKKHGVYN 166 human
P06994    63 -ATPALEGADVVLISAGVARKPGMDRSDLFNVNAGIVKNLVQQVAKTCPKAC--IGIITNPVNTTVAIAAEVLKKAGVYD 139 Escherichia coli
P40926    86 -LPDCLKGCDVVVIPAGVPRKPGMTRDDLFNTNATIVATLTAACAQHCPEAM--ICVIANPVNSTIPITAEVFKKHGVYN 162 human
P17505    80 gLNNALKDTDMVLIPAGVPRKPGMTRDDLFAINASIVRDLAAATAESAPNAA--ILVISNPVNSTVPIVAQVLKNKGVYN 157 Saccharomyces cerev...
AAL90140  89 -LKKAMDKADIVVIPAGLPRKPGMKREDLVDVNASVACEVAFAASEVCPGAM--LAFITNPINVIVPIVATILKAKGTYD 165 fruit fly
CAB55506  70 aLAELAKGVDVFVMVAGVPRKPGMTRDDLFKINAGIILDLVLTCASSSPKAV--FCIVTNPVNSTVAIAAEALKSLGVYD 147 Leishmania major
P32419    62 -IENTLSNAQVVLIPAGVPRKPGLTRDDLFKMNAGIVKSLVTAVGKFAPNAR--ILVISNPVNSLVPIAVETLKKMGKFK 138 Saccharomyces cerev...
P22133    88 -IENCLHNASIVVIPAGVPRKPGMTRDDLFNVNAGIISQLGDSIAECCDLSKvfVLVISNPVNSLVPVMVSNILKNHPQS 166 Saccharomyces cerev...
2PWZ_A    63 -ATPALEGADVVLISAGVARKPGMDRSDLFNVNAGIVKNLVQQVAKTCPKAC--IGIITNPVNTTVAIAAEVLKKAGVYD 139 Escherichia coli
2DFD_A   167 PNK-----IFGVTTLDIVRANTFVAELKGLD-----------PARvNVPVIGGHAGKTIIPLISQCTPkVDFPQDQLTAL 230 human
P06994   140 KNK-----LFGVTTLDIIRSNTFVAELKGKQ-----------PGEvEVPVIGGHSGVTILPLLSQVPG-VSFTEQEVADL 202 Escherichia coli
P40926   163 PNK-----IFGVTTLDIVRANTFVAELKGLD-----------PARvNVPVIGGHAGKTIIPLISQCTPkVDFPQDQLTAL 226 human
P17505   158 PKK-----LFGVTTLDSIRAARFISEVENTD-----------PTQeRVNVIGGHSGITIIPLISQTNH-KLMSDDKRHEL 220 Saccharomyces cerev...
AAL90140 166 PNR-----LFGVTTLDVVRAQTFVADILNVD-----------PQKvNIPVIGGHTGRTILPILSQCDPpFKGTDKEREAL 229 fruit fly
CAB55506 148 RNR-----LLGVSLLDGLRATCFINEAR-KP-----------LVVsQVPVVGGHSDTTIVPLFYQLPG-PLPEQATLDKI 209 Leishmania major
P32419   139 PGN-----VMGVTNLDLVRAETFLVDYLMLKnpkigqeqdktTMHrKVTVIGGHSGETIIPIITDKSLvFQLDK-QYEHF 212 Saccharomyces cerev...
P22133   167 RNSgierrIMGVTKLDIVRASTFLREINIESgltp----rvnSMP-DVPVIGGHSGETIIPLFSQSNFlSRLNEDQLKYL 241 Saccharomyces cerev...
2PWZ_A   140 KNK-----LFGVTTLDIIRSNTFVAELKGKQ-----------PGEvEVPVIGGHSGVTILPLLSQVPG-VSFTEQEVADL 202 Escherichia coli
2DFD_A   231 TGRIQEAGTEVVKAKAGAGSATLSMAYAGARFVFSLVDAMNG----KEGVVECSFVK--SQ----------------ETE 288 human
P06994   203 TKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVRALQG----EQGVVECAYVE--GD----------------GQY 260 Escherichia coli
P40926   227 TGRIQEAGTEVVKAKAGAGSATLSMAYAGARFVFSLVDAMNG----KEGVVECSFVK--SQ----------------ETE 284 human
P17505   221 IHRIQFGGDEVVKAKNGAGSATLSMAHAGAKFANAVLSGFKG----ERDVIEPSFVD--SPlf-------------kSEG 281 Saccharomyces cerev...
AAL90140 230 IQRIQNAGTEVVNAKDGLGSATLSMAFAATQFVNSLIKGIKGs--kDECIVECAYVE--SD----------------VTE 289 fruit fly
CAB55506 210 VKRVQVAGTEVVKAKAGRGSATLSMAEAGARFALKVVEGLTG----TGNPLVYAYVD--TDg---------------QHE 268 Leishmania major
P32419   213 IHRVQFGGDEIVKAKQGAGSATLSMAFAGAKFAEEVLRSFHNekpeTESLSAFVYLPglKNgkkaq-------qlvgDNS 285 Saccharomyces cerev...
P22133   242 IHRVQYGGDEVVKAKNGKGSATLSMAHAGYKCVVQFVSLLLGn---IEQIHGTYYVPl-KDannfpiapgadqllplVDG 317 Saccharomyces cerev...
2PWZ_A   203 TKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVRALQG----EQGVVECAYVE--GDg---------------Q-Y 260 Escherichia coli
2DFD_A   289 CTYFSTPLLLGKKGIE--KNLGIGKVSSFE-EKMISDAIPELKA----SIKKGEDFVKT 340 human
P06994   261 ARFFSQPLLLGKNGVE--ERKSIGTLSAFE-QNALEGMLDTLKK----DIALGEEFVNK 312 Escherichia coli
P40926   285 CTYFSTPLLLGKKGIE--KNLGIGKVSSFE-EKMISDAIPELKA----SIKKGEDFVKT 336 human
P17505   282 IEFFASPVTLGPDGIE--KIHPIGELSSEE-EEMLQKCKETLKK----NIEKGVNFVAS 333 Saccharomyces cerevisiae S288c
AAL90140 290 AQFFATPLILGPQGVK--ENTGLPDLDDEE-RKALNGMLPILKEsiakGIKLGEGMICS 345 fruit fly
CAB55506 269 TTFLAIPVVLGMNGIE--KRLPIGPLHSTE-ETLLKAALPVIKK----NIVKGSEFARS 320 Leishmania major
P32419   286 IEYFSLPIVLRNGSVVsiDTSVLEKLSPRE-EQLVNTAVKELRK----NIEKGKSFILD 339 Saccharomyces cerevisiae S288c
P22133   318 ADYFAIPLTITTKGVSyvDYDIVNRMNDMErNQMLPICVSQLKK----NIDKGLEFVAS 372 Saccharomyces cerevisiae S288c
2PWZ_A   261 ARFFSQPLLLGKNGVE--ERKSIGTLSAFE-QNALEGMLDTLKK----DIALGEEFVNK 312 Escherichia coli
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap