Conserved Protein Domain Family
GGGP

?
TIGR01769: GGGP 
phosphoglycerol geranylgeranyltransferase
This model represents geranylgeranylglyceryl phosphate synthase which catalyzes the first committed step in the synthesis of ether-linked membrane lipids in archaea. The active enzyme is reported to be a homopentamer in Methanobacterium thermoautotrophicum but is reported to be a homodimer in Thermoplasma acidophilum.
Statistics
?
PSSM-Id: 130830
View PSSM: TIGR01769
Aligned: 4 rows
Threshold Bit Score: 256.262
Threshold Setting Gi: 7674151
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAL64634      13 HFTLIDPDKs---VDYLKIAKYALEAgTDGILIGGSLGIResQIAQVVKDIKNISNVPVVLFPGSLTQLTDLADGVLFLS 89  Pyrobaculum aer...
Q58647        23 YLTLLDPEE----ENIEEIAENVKDY-ADAIMVGGSIGIV--NLDETVKKIKKITKLPIILFPGNVDGLSRYADAVFYMS 95  Methanocaldococ...
BAB59887      10 HMTLIDPAAks-pDESAKIAKEAEMAgTDFIMVGGSTDIDerLMDQTVSAIKENTNLKVILFPGSSNMISRHADAIFFMS 88  Thermoplasma vo...
WP_014511517  22 HFSLIDPFKinssDELKYITKNLYNAgTDAFLIGGTLGVSkdKLDFVISLLD-DYEIPKIIFPSNINLLSEKADALLFMS 100 Sulfolobus solf...
AAL64634      90 VLNSLDPYFIIGAQIQGAVLIAKHYprLEVISTAYIIVGDGG--AAGFVSMSKPIPYTRPDIAAAYALAANYIGFKAVYL 167 Pyrobaculum aer...
Q58647        96 LMNSANTYWVVTAPTLGAITILKYN--LEPIPMAYLCIEPAKktAVGYVGEIREIPQNKPKITAMYCLSAKFFGMRWAYL 173 Methanocaldococ...
BAB59887      89 LLNSSDREFIVGHQVKASKFLSLLG--IEKIPMAYLVFSPGM--TVGRVGKANLIDSFDRETALSYSLAAQYMGFKLIYF 164 Thermoplasma vo...
WP_014511517 101 LLNSDDIYYIIGAQIVAAPIIKMLQ--MEVIPTAYVIVGHGG--TAAHIGKARVIPYDNFELATAYTLAAEYLGMSFVYL 176 Sulfolobus solf...
AAL64634     168 EAGSGASQPVPPEMVRAVRRAFpR-VLIVGGGIKSGEIARAIARERPNVIVTG 219 Pyrobaculum aerophilum str. IM2
Q58647       174 EAGSGASYPVNNETIALSKKLS-GiNIIVGGGIRKPEIAYEKVLAGADAIVTG 225 Methanocaldococcus jannaschii DSM 2661
BAB59887     165 EAGSGAPRPVSEDTISYVKSKI-NiPLIVGGGIRDPETAMRIALAGADMIVTG 216 Thermoplasma volcanium GSS1
WP_014511517 177 EAGSGAPEPIRPEMISFIKNAS-SiPLIVGGGIRSVEVALKLVEAGADIIVTG 228 Sulfolobus solfataricus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap