2OLC


Conserved Protein Domain Family
MTRK

?
TIGR01767: MTRK 
Click on image for an interactive view with Cn3D
S-methyl-5-thioribose kinase
This enzyme, S-methyl-5-thioribose kinase (MtnK) is involved in the methionine salvage pathway in certain bacteria.
Statistics
?
PSSM-Id: 130828
View PSSM: TIGR01767
Aligned: 4 rows
Threshold Bit Score: 637.698
Threshold Setting Gi: 499217192
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2OLC_A        36 QEIGDGNLNYVFHIYDQEHDRALIIKQAVPYAKVVGESWPLTIDRARIESSALIRQGEHVPHLVPRVFYSDTEMAVTVME 115 Bacillus subtil...
WP_003232497  38 QEIGDGNLNYVFHIYDQEHDRALIIKQAVPYAKVVGESWPLTIDRARIESSALIRQGEHVPHLVPRVFYSDTEMAVTVME 117 Bacillus subtilis
WP_010914732  39 REVGDGNLNLVFIVEGAGG--AAVVKQALPYVRLVGDSWPLPLKRSFFEYHALTRQEARAPGSVPAIYHFDEGQALIIME 116 Mesorhizobium loti
AAG43573      32 QEVGDGNLNLVFKVFDRQGVSRAIVKQALPYVRCVGESWPLTLDRARLEAQTLVAHYQHSPQHTVKIHHFDPELAVMVME 111 Klebsiella pneu...
2OLC_A       116 DLSH-LKIARKGLIEGENYPHLSQHIGEFLGKTLFYSSDYALEPKVKKQLVKQFT-NPELCDITERLVFTDPFFDHDTND 193 Bacillus subtil...
WP_003232497 118 DLSH-LKIARKGLIEGENYPHLSQHIGEFLGKTLFYSSDYALEPKVKKQLVKQFT-NPELCDITERLVFTDPFFDHDTND 195 Bacillus subtilis
WP_010914732 117 YLAPpHVILRRALIDGRQLPNIARDIGLFMARTLFRGSDLSMVTKDRKADLALFAdNVELCDITENLVFSDPYFDAKMNR 196 Mesorhizobium loti
AAG43573     112 DLSD-HRIWRGELIANVYYPQAARQLGDYLAQVLFHTSDFYLHPHEKKAQVAQFI-NPAMCEITEDLFFNDPYQIHERNN 189 Klebsiella pneu...
2OLC_A       194 FEEELRPFVEKLWNNDSVKIEAAKLKKSFLTSAETLIHGDLHTGSIFASEHETKVIDPEFAFYGPIGFDVGQFIANLFLN 273 Bacillus subtil...
WP_003232497 196 FEEELRPFVEKLWNNDSVKIEAAKLKKSFLTSAETLIHGDLHTGSIFASEHETKVIDPEFAFYGPIGFDVGQFIANLFLN 275 Bacillus subtilis
WP_010914732 197 HTPQLDSVVAELRADRDLKVEAQRLKHIFAANAETLLHGDLHSGSIMVTDTETRMIDPEFAFYGPMAFDIGMLLANFWMS 276 Mesorhizobium loti
AAG43573     190 YPAELEADVAALRDDAQLKLAVAALKHRFFAHAEALLHGDIHSGSIFVAEGSLKAIDAEFGYFGPIGFDIGTAIGNLLLN 269 Klebsiella pneu...
2OLC_A       274 ALSRDGAD--------REPLYEHVNQVWETFEETFSEAWQKDSLD---VYAN--IDGyl---------tDTLSHIFEEAI 331 Bacillus subtil...
WP_003232497 276 ALSRDGAD--------REPLYEHVNQVWETFEETFSEAWQKDSLD---VYAN--IDGyl---------tDTLSHIFEEAI 333 Bacillus subtilis
WP_010914732 277 FFSQRGHEqkgkrdamRAYLLGVTKETWSVFRAEFSHLWRTERAGm--LYQKslFEDqgdrlgaeqaldHVLHQIWTDLL 354 Mesorhizobium loti
AAG43573     270 YCGLPGQLgirdaaaaREQRLNDIHQLWTTFAERFQALAAEKTRDaalAYPG--YAS------------AFLKKVWADAV 335 Klebsiella pneu...
2OLC_A       332 GFAGCELIRRTIGLAHVADLDTIVPFDKRIGRKRLALETGTAFIEKRSEFKTITDVielFKLLVK 396 Bacillus subtilis subsp. subti...
WP_003232497 334 GFAGCELIRRTIGLAHVADLDTIVPFDKRIGRKRLALETGTAFIEKRSEFKTITDVielFKLLVK 398 Bacillus subtilis
WP_010914732 355 GFAGIEVHRRILGLAHNADFETIADEALRASCEAKALKFGRHIAVNRRQIHSIDEVntlAALIEQ 419 Mesorhizobium loti
AAG43573     336 GFCGSELIRRSVGLSHVADIDTIQDDAMRHECLRHAITLGRALIVLAERIDSVDEL---LARVRQ 397 Klebsiella pneumoniae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap