2FCT


Conserved Protein Domain Family
chlorin-enz

?
TIGR01762: chlorin-enz 
Click on image for an interactive view with Cn3D
chlorinating enzyme
This model represents a a group of highly homologous enzymes related to dioxygenases which chlorinate amino acid methyl groups. BarB1 and BarB2 are proposed to trichlorinate one of the methyl groups of a leucine residue in the biosynthesis of barbamide in the cyanobacterium Lyngbya majuscula. SyrB2 is proposed to chlorinate the methyl group of threonine in the biosynthesis of syringomycin in Pseudomonas syringae. CmaB is proposed to chlorinate the beta-methyl group of alloisoleucine in the process of ring closure in the biosynthesis of coronamic acid, a component of coronatine also in Pseudomonas syringae.
Statistics
?
PSSM-Id: 130823
View PSSM: TIGR01762
Aligned: 4 rows
Threshold Bit Score: 544.109
Threshold Setting Gi: 23452292
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2FCT_A         8 FALTAEQRASFEKNGFIGPFDAYSPEEMKETWKRTRLRLLDRSAAAYQdldaisggTNIANYDRHLDDDFLASHICRPEI 87  Pseudomonas syr...
AAN32975      11 YYLSVEEKQFFRDNGYIGPFTLFQPEEILELWNEIRMDLLDRETAPFP--------NSKMNYDRHLDIQALSDIISHPKI 82  Lyngbya majuscula
WP_005888848   6 FSLTKQELQQFDRDGFIGPFTLYEPEEMKQMHKTIRAQLFNRTHAPYDap----ldVAITNYDRHLDVDLLTSHVFRKEI 81  Pseudomonas syr...
AAD50521       5 FALTAEQRASFEKNGFIGPFDAYSPEEMKETWKRTRLRLLDRSAAAYQdldaisggTNIANYDRHLDDDFLASHICRPEI 84  Pseudomonas syr...
2FCT_A        88 CDRVESILGPNVLCWRTEFFPKYPGDEGTDWHQADTFANASGKPQIIWPENEEFGGTITVWTAFTDANIANGCLQFIPGT 167 Pseudomonas syr...
AAN32975      83 AHRVSSLLGSNVLCWRTAWFPKYPGDEGTDWHQAESFVEFEGKSKLVPTESHDGPWELTAWVAFSEATRENGCMKVMPGT 162 Lyngbya majuscula
WP_005888848  82 VHRVRSILGPDVICWRSEFIPKYPGNEGTDWHQADTFAHASGEPQLVWPEGEPFGGAINVWTGFTDATQENGCMQFIPGS 161 Pseudomonas syr...
AAD50521      85 CDRVESILGPNVLCWRTEFFPKYPGDEGTDWHQADTFANASGKPQIIWPENEEFGGTITVWTAFTDANIANGCLQFIPGT 164 Pseudomonas syr...
2FCT_A       168 QNSMNYDETKRMTYEPDANNSVVKDGVRRGFFGYDYRQLQIDENWKPDEASAVPMQMKAGQFIIFWSTLMHASYPHSGES 247 Pseudomonas syr...
AAN32975     163 HNTWYFDEHRNIEFEPDKINQKLTGGKKTGVYGYDYYKLKLDPNWEPDESQAVHLEMEPGQFILFTSRCMHGSEPNTSGS 242 Lyngbya majuscula
WP_005888848 162 HKQMNYDETRGMTFDPVTNNNVVKGQYPRGFNGYDYTTLQKDKSWKPDEASAVPIVMKAGQFVIFRSMLMHSSLPNSTPD 241 Pseudomonas syr...
AAD50521     165 QNSMNYDETKRMTYEPDANNSVVKDGVRRGFFGYDYRQLQIDENWKPDEASAVPMQMKAGQFIIFWSTLMHASYPHSGES 244 Pseudomonas syr...
2FCT_A       248 QeMRMGFASRYVPSFVHVYPDSDHIEEYGGRISLEKYGAVQVIGDETPEYNRL 300 Pseudomonas syringae pv. syringae
AAN32975     243 S-IRYGWSTRFVPTDVRVYPDWESFQHFGEVFPLERYATVLVAGEDTYKHNKI 294 Lyngbya majuscula
WP_005888848 242 K-TRLGYVARYVPGRVKVYPDTDYVKEFGGEYRLDRFGVVQVSGTTTDPKNRV 293 Pseudomonas syringae group
AAD50521     245 QeMRMGFASRYVPSFVHVYPDSDHIEEYGGRISLEKYGAVQVIGDETPEYNRL 297 Pseudomonas syringae pv. syringae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap