Conserved Protein Domain Family
Malate-DH_plant

?
TIGR01757: Malate-DH_plant 
malate dehydrogenase, NADP-dependent
This model represents the NADP-dependent malate dehydrogenase found in plants, mosses and green algae and localized to the chloroplast. Malate dehydrogenase converts oxaloacetate into malate, a critical step in the C4 cycle which allows circumvention of the effects of photorespiration. Malate is subsequenctly transported from the chloroplast to the cytoplasm (and then to the bundle sheath cells in C4 plants). The plant and moss enzymes are light regulated via cysteine disulfide bonds. The enzyme from Sorghum has been crystallized.
Statistics
?
PSSM-Id: 130818
View PSSM: TIGR01757
Aligned: 3 rows
Threshold Bit Score: 786.474
Threshold Setting Gi: 19069739
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAC19083  27 VVRAVAAPVAPAAEAEAKK-AYGVFRLSYDTQNEDAslTRSWKKTVKVAVTGASGNIANHLLFMLASGEVYGKDQPIALQ 105 Chlamydomonas reinh...
P17606    44 AAKQVQDGVATAEAPATRKdCFGVFCTTYDLKAEDK--TKSWKKLVNIAVSGAAGMISNHLLFKLASGEVFGQDQPIALK 121 sorghum
CAC16124  16 AALSVRAAAGAEVAAASKS--YGVFKLSYSIDNEPKqrTQSWKATINVVVSGAAGQISNHLLFMLASGSVFGNDQPIALR 93  Scherffelia dubia
CAC19083 106 LLGSERSKEALEGVAMELEDSLYPLLREVSIGTDPYEVFGDADWALMIGAKPRGPGMERADLLQQNGEIFQVQGRALNES 185 Chlamydomonas reinh...
P17606   122 LLGSERSFQALEGVAMELEDSLYPLLREVSIGIDPYEVFEDVDWALLIGAKPRGPGMERAALLDINGQIFADQGKALNAV 201 sorghum
CAC16124  94 LLGSERSKEALEGVAMELEDSLYPLLREVVIGIDPLEVFAEADWALLIGAKPRGPGMERADLLDINGRIFVDQGQALNRV 173 Scherffelia dubia
CAC19083 186 ASRNCKVLVVGNPCNTNALIAMENAPNIPRKNFHALTRLDENRAKCQLALKSGKFYTSVSRMAIWGNHSTTQVPDFVNAR 265 Chlamydomonas reinh...
P17606   202 ASKNVKVLVVGNPCNTNALICLKNAPDIPAKNFHALTRLDENRAKCQLALKAGVFYDKVSNVTIWGNHSTTQVPDFLNAK 281 sorghum
CAC16124 174 AKKTCKVLVVGNPCNTNALIAMLNAPNIPRKNFHALTRLDENRAKCQLALKSGKFYTSVTNVTIWGNHSTTQVPDFVNAK 253 Scherffelia dubia
CAC19083 266 IGGLPAPDVIRDMKWFREEFTPKVALRGGALIKKWGRSSAASTAVSVADAIRALVVPTAPGDCFSTGVISDGNPYGVREG 345 Chlamydomonas reinh...
P17606   282 IDGRPVKEVIKDTKWLEEEFTITVQKRGGALIQKWGRSSAASTAVSIADAIKSLVTPTPEGDWFSTGVYTTGNPYGIAED 361 sorghum
CAC16124 254 IGGKPATSVITDTAYLKEKFTPLVQTRGGALIKKWGRSSAASTAVSIADAIKSLVVPTPAGDWFSTAVCTDGNPYGIQEG 333 Scherffelia dubia
CAC19083 346 LIFSFPCRSKGDGDYEICDNFIVDEWLRAKIRASEDELQKEKECVSHLIGMMGGSCALRgaEDTTVPGEN 415 Chlamydomonas reinhardtii
P17606   362 IVFSMPCRSKGDGDYELATDVSMDDFLWERIKKSEAELLAEKKCVAHLTGEGNAYCDVP--EDTMLPGEV 429 sorghum
CAC16124 334 LVFSMPCRSTGDGDYEVVPGLVIDDYLREALRKTEDELVKEKECVGHLIGNPDAACAIT--EDTMLAGEN 401 Scherffelia dubia
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap