Conserved Protein Domain Family
LDH_protist

?
TIGR01756: LDH_protist 
lactate dehydrogenase
This model represents a family of protist lactate dehydrogenases which have aparrently evolved from a recent protist malate dehydrogenase ancestor. Lactate dehydrogenase converts the hydroxyl at C-2 of lactate to a carbonyl in the product, pyruvate. The preference of this enzyme for NAD or NADP has not been determined. A critical residue in malate dehydrogenase, arginine-91 (T. vaginalis numbering) has been mutated to a leucine, eliminating the positive charge which complemeted the carboxylate in malate which is absent in lactate. Several other more subtle changes are proposed to make the active site smaller to accomadate the less bulky lactate molecule.
Statistics
?
PSSM-Id: 130817
View PSSM: TIGR01756
Aligned: 3 rows
Threshold Bit Score: 582.225
Threshold Setting Gi: 15620523
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAG10053   1 MAFRIANGDLLGNRRVCLHLLELPVALKACEGLALELEDCAFQNLEKTIVTDKLEEACKDIDIAFLVASVPLKPGEHRVN 80  Hypotrichomonas acosta
AAG10056   4 LSHWIAGGELYGERPVFLHLFDIPPAMNRLTALTMELEDCAFPHLAGYVATTNPEEAFKDIDCAFLVASMPLKPGQVRAD 83  Tetratrichomonas ga...
AAG10051   4 LSHWIASGALYGDRPVVLHLLEIKPAINRLEALCMELQDCAFPTLAGVIGTTEYEPAFSGIDCAFLVASVPLRQGEVRAD 83  Pentatrichomonas ho...
AAG10053  81 LLTKNTPIFKAIGEALSEYAKPTVRALVVGNPVNSNCLVAMLNAPKLSAENFSCMCTLDHNRSVSRIASHLKVPIDHVYH 160 Hypotrichomonas acosta
AAG10056  84 LISSNSVIFKNTGEYLSQWAKPTVKVLVIGNPDNTNCEIAMLHAKNLKPENFSSLLMLDQNRAYYEIASKLNVDVKDIHN 163 Tetratrichomonas ga...
AAG10051  84 LLKKNASIFKATGEALGRYAKRTVKVLTIGNPCNTNALVAMLHASGLSEKNFHSLSMLDYNRAVHMLASKFGVEVGEIRD 163 Pentatrichomonas ho...
AAG10053 161 VAVWGNHAETQVPDITHVEVTDeNGTHRKAFDELCRIEPEPDFIEVIAQRAWKVLEMRGKTSAGSAVNAALCHMRAWLFG 240 Hypotrichomonas acosta
AAG10056 164 IVVWGNHGESMVAGLTQATFTK-GGKEQKVIDALDKDYVFDTFFKKISHRAWDILEHRGFTSAASPTKASIQHMKAWLFG 242 Tetratrichomonas ga...
AAG10051 164 MVVWGNHAESMVADLSHAYFVK-DGKKQMVKELVSEDYAKGEFFTTIAGRAWAIMERRGFTSAASPSKASLQHMKAWLFG 242 Pentatrichomonas ho...
AAG10053 241 TRPNDWISLGIPVPEGNSYGIKPGIIFSFPCTVDEKGKVHIVENLELNPEIKTKIAQTEKDLFEERETALKALA 314 Hypotrichomonas acosta
AAG10056 243 TKPGEVLSMGIPVPEDNPYGIKPGVVFSFPCTVDTDGKIHVVEGFKVNDWLRQKLNFTENDLINEKRIALEHLS 316 Tetratrichomonas gallinarum
AAG10051 243 TEEGEVLSMGIPVPESCPYGINPGVLFSFPCTVDKDGEVHVKEDFPIDSWLAEKLKDTDEDLRHEREVALQVLA 316 Pentatrichomonas hominis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap