4DY4


Conserved Protein Domain Family
flav_wrbA

?
TIGR01755: flav_wrbA 
Click on image for an interactive view with Cn3D
NAD(P)H:quinone oxidoreductase, type IV
This model represents a protein, WrbA, related to and slightly larger than flavodoxin. It was just shown, in E. coli and Archaeoglobus fulgidus (and previously for some eukaryotic homologs) to act as fourth type of NAD(P)H:quinone oxidoreductase. In E. coli, this protein was earlier reported to be produced during stationary phase, bind to the trp repressor, and make trp operon repression more efficient. WrbA does not interact with the trp operator by itself. Members are found in species in which homologs of the E. coli trp operon repressor TrpR (SP:P03032) are not detected. [Energy metabolism, Electron transport]
Statistics
?
PSSM-Id: 130816
View PSSM: TIGR01755
Aligned: 5 rows
Threshold Bit Score: 339.95
Threshold Setting Gi: 459358574
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4DY4_A   1 AKVLVLYYSMYGHIETMARAVAEGASKVdGAEVVVKRVPETMPPQLFEKA----GGKT-QTAPVATPQE----LADYDAI 71  Escherichia coli APEC O1
P58795   2 TKVLVLYYSSYGHIETMAYAVAEGVEST-GAEAVVKRVPELVPEEVAKSS----HFKMdQPAPVATVDE----LAEYDAI 72  Agrobacterium fabrum ...
Q8YH68   2 VKMLVLYYSAYGYMEQMAKAAAEGAREG-GAEVTLKRVPELVPEEVAKAS----HYKIdQEAPIATPGE----LADYDAI 72  Brucella melitensis b...
P30849   2 AKVLVLYYSMYGHIETMARAVAEGASKVdGAEVVVKRVPETMPPQLFEKA----GGKT-QTAPVATPQE----LADYDAI 72  Escherichia coli
P58796   2 VKVNIIFYSMYGHVYRMAEAVAAGAREVeGAEVGIYQVPETLPEEVLEKMgaieTKKLfAHIPVLTREMneevLAGADAL 81  Methanosarcina acetiv...
4DY4_A  72 IFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLASVFSSTGTG-GGQEQTITSTWTTLAHHGMVIVPIGYAAQELFDV 150 Escherichia coli APEC O1
P58795  73 IVGAGTRFGTVASQMRNFWDQTGGLWFSGKLVGKVGSAFTSSATQhGGQESTILGFIPTFLHHGMAVVGLPYAFQGQMGV 152 Agrobacterium fabrum ...
Q8YH68  73 IIGTATRYGMMASQMKNFLDQTGGLWAKGALINKVGSVMVSTATQhGGAELALISTQWQMQHHGMIIVPLSYAYREQMGN 152 Brucella melitensis b...
P30849  73 IFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLASVFSSTGTG-GGQEQTITSTWTTLAHHGMVIVPIGYAAQELFDV 151 Escherichia coli
P58796  82 IFGTPTRYGNMTAQMRAVLDGLGGLWNRDAFVGKVGSVFTSSGTQhGGQESTILTFHVTLLHLGMILVGLPYSEKRQTRM 161 Methanosarcina acetiv...
4DY4_A 151 SQVRGGTPYGATTIAGGDGSRQPSQEELSIARYQGEYVAGLAVKL 195 Escherichia coli APEC O1
P58795 153 DEIKGGSPYGASTITDGDGSRQPSAIELDAARYQGAHVAKLAAKL 197 Agrobacterium fabrum str. C58
Q8YH68 153 DVVRGGAPYGMTTTADGDGSRQPSAQELDGARFQGRRVAEITAKL 197 Brucella melitensis bv. 1 str. 16M
P30849 152 SQVRGGTPYGATTIAGGDGSRQPSQEELSIARYQGEYVAGLAVKL 196 Escherichia coli
P58796 162 DEITGGSPYGVSTIAGGDGSRQPSENELAMARYQGRHVTLIAKKI 206 Methanosarcina acetivorans C2A
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap