Conserved Protein Domain Family
flav_RNR

?
TIGR01754: flav_RNR 
ribonucleotide reductase-associated flavodoxin, putative
This model represents a family of proteins found immediately downstream of ribonucleotide reductase genes in Xyella fastidiosa and some Gram-positive bacteria. It appears to be a highly divergent flavodoxin of the short chain type, more like the flavodoxins of the sulfate-reducing genus Desulfovibrio than like the NifF flavodoxins associated with nitrogen fixation.
Statistics
?
PSSM-Id: 130815
View PSSM: TIGR01754
Aligned: 3 rows
Threshold Bit Score: 242.474
Threshold Setting Gi: 499379914
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_010893708   1 MRILLALASLSGNTREVARIIRARCEERGHRVdwIETDLQTLAGQALDpRTYTLFLLGTWTDNAGRTPFEMKRFIAELLE 80  Xylella fastidiosa
WP_010989907   1 MRILLAYDSLSGNTKMVADEIEEILISEGHEV--VSFRVSPLAEYPLD-EDFDLYVLGAWTVDYGRTPPDMKDFIAELAV 77  Listeria monocy...
WP_011067485   1 MRMIIAYLTYSGNTEEVAFMIQDYLQKDGVEVd--LHRIG--IDAPFHpENYDLVFLGTFTWERGATPDEVKDFVWEIGY 76  Oceanobacillus ...
WP_010893708  81 ligKPPSVAVFGTGETQW-GQEYYCGAVHRVADFFSSRFPRLLIEQMPHGERDGRAIAEWIDQVL 144 Xylella fastidiosa
WP_010989907  78 ---KPKNVAIFGTGETQW-GMDFYCGAVDRMAKYFGTSYPTLKIEQMPHTEQDVADIDNWVRKIL 138 Listeria monocytogenes
WP_011067485  77 ---KPSNMVIFGTGDTQFgGDDLFCKAVDKLSHFYGSSHPVLKIEQSPRGYQQ-RAVYDWLEGVL 137 Oceanobacillus iheyensis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap