1U1Z,2GLL,4I83


Conserved Protein Domain Family
fabZ

?
TIGR01750: fabZ 
Click on image for an interactive view with Cn3D
beta-hydroxyacyl-[acyl carrier protein] dehydratase FabZ
This enzyme, FabZ, shows overlapping substrate specificity with FabA with regard to chain length in fatty acid biosynthesis. FabZ works preferentially on shorter chains and is often designated (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase, although its actual specificity is broader. Unlike FabA, FabZ does not function as an isomerase and cannot initiate unsaturated fatty acid biosynthesis. However, only FabZ can act during the elongation of unsaturated fatty acid chains. [Fatty acid and phospholipid metabolism, Biosynthesis]
Statistics
?
PSSM-Id: 130811
View PSSM: TIGR01750
Aligned: 15 rows
Threshold Bit Score: 208.71
Threshold Setting Gi: 14423712
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1U1Z_A  23 DINEIREYLPHRYPFLLVDRVVELDieGKRIRAYKNVSINEPFFNGHFPEHPIXPGVLIIEAXAQAAGILGFKXLDV--- 99  Pseudomonas aeruginosa
Q9FBC0   3 DIQGIKEALPHRYPMLLVDRVLEVS--EDTIVAIKNVTINEPFFNGHFPQYPVMPGVVIMEALAQTAGVLELSKPEN--- 77  Streptococcus pneumoniae
Q9PJL0   8 GIQDIQNLLPHRYPFLLVDKILSYDlnTRSIVAQKNVTINEPFFVGHFPEAPIMPGVLILEALAQAAGVLLGIILEN--- 84  Chlamydia muridarum s...
P73848  25 TIQEISDLLPHRYPFALVDRIIDFQp-GKCAVGLKNVTINEPFFPGHIPDRPIMPGVLIVESMAQVGGVIL-TQLPG--- 99  Synechocystis sp. PCC...
Q9JX28   8 EAKDIQKLIPHRYPFLQLDRITAFEp-MKTLTAIKNVTINEPQFQGHFPDLPVMPGVLIIEAMAQACGTLAILSEGG--- 83  Neisseria meningitidi...
Q9X5F5  15 DVKRVMAALPHRFPMLLVDRVETLIp-GEKIVAIKAVTINEPFFTGHFPGNPIMPGVLIVEALAQAAGVLAIESLG---- 89  Zymomonas mobilis sub...
Q9ZJL6  13 FIEHILQILPHRYPMLLVDRIIELQa-NQKIVAYKNITFNEDVFNGHFPNKPIFPGVLIVEGMAQTGGFLAFTSLWGfdp 91  Helicobacter pylori J99
Q98MC5  11 DIMGLMKLLPHRYPFLMIDRIIDIDg-DDSAIGIKNVTINEPHFQGHFPEQPVMPGVLIVEAMAQTAGAICIRSLG---- 85  Mesorhizobium loti MA...
Q97DA9   4 SIEQIMEIIPHRYPMLLVDRVEEIEp-GKRAVGYKNVTFNEQIFQGHYPGKPIMPGVLMIEALAQLGG-VAILSLD---- 77  Clostridium acetobuty...
2GLL_A  25 FIEHILQILPHRYPMLLVDRITELQa-NQKIVAYKNITFNEDVFNGHFPNKPIFPGVLIVEGMAQSGGFLAFTSLWGfdp 103 Helicobacter pylori SS1
1U1Z_A 100 KPADgTLYYFVGSDKLRFRQPVLPGDQLQLHAKFI-SVKRSIWKFDCHATVDDKPVCSAEIICAE 163 Pseudomonas aeruginosa
Q9FBC0  78 KGK---LVFYAGMDKVKFKKQVVPGDQLVMTATFV-KRRGTIAVVEAKAEVDGKLAASGTLTFAI 138 Streptococcus pneumoniae
Q9PJL0  85 DRDK-KIALFLGIQKAKFRQPVKPGDVLILKAEFS-LISAKGGKAIAQAFVGSQIVAEGELSFVL 147 Chlamydia muridarum str. Nigg
P73848 100 MRG--KFFAFAGIDGVRFRRPVVPGDQLIMTVELQsFKLQRIAKMQGEARVDGQLVCGGEMLFSL 162 Synechocystis sp. PCC 6803 substr. K...
Q9JX28  84 RKEN-EFFFFAGIDEARFKRQVIPGDQLVFEVELL-TSRRGIGKFNAVAKVDGQVAVEAVIMCAK 146 Neisseria meningitidis Z2491
Q9X5F5  90 LTGTgKLVYFMAINETKFRIPVEPGILLRLEVEFL-QKRAKICKFKARALIEDKVAAETEFTAMI 153 Zymomonas mobilis subsp. mobilis ZM4...
Q9ZJL6  92 EIAKtKIVYFMTIDKVKFRIPVTPGDRLEYHLEVL-KHKGMIWQVGGTAQVDGKVVAEAELKAMI 155 Helicobacter pylori J99
Q98MC5  86 -ASKpSLVYFLTIDNAKFRKPVVPGDQLKIHVKKI-KKRGNLLKFACEALVDGTKAAEAEISAMM 148 Mesorhizobium loti MAFF303099
Q97DA9  78 -KYKgKKPILGAVKNAKFRRMVVPGDVLKLEIEIV-KVKGPAGIGKGIATVNGEKAVEAEITFMI 140 Clostridium acetobutylicum ATCC 824
2GLL_A 104 EIAKtKIVYFMTIDKVKFRIPVTPGDRLEYHLEVL-KHKGMIWQVGGTAQVDGKVVAEAELKAMI 167 Helicobacter pylori SS1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap