4B8U,1MKB


Conserved Protein Domain Family
fabA

?
TIGR01749: fabA 
Click on image for an interactive view with Cn3D
beta-hydroxyacyl-[acyl carrier protein] dehydratase FabA
This enzyme, FabA, shows overlapping substrate specificity with FabZ with regard to chain length in fatty acid biosynthesis. It is commonly designated 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase (EC 4.2.1.60) as if it were specific for that chain length, but its specificity is broader; it is active even in the initiation of fatty acid biosynthesis. This enzyme can also isomerize trans-2-decenoyl-ACP to cis-3-decenoyl-ACP to bypass reduction by FabI and instead allow biosynthesis of unsaturated fatty acids. FabA cannot elongate unsaturated fatty acids. [Fatty acid and phospholipid metabolism, Biosynthesis]
Statistics
?
PSSM-Id: 130810
View PSSM: TIGR01749
Aligned: 7 rows
Threshold Bit Score: 330.993
Threshold Setting Gi: 21362553
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4B8U_A   3 KQHAFTREDLLRCSRGELFGPGNAQLPAPNMLMIDRIVHISDVGGKYGKGELVAELDINPDLWFFACHFEGDPVMPGCLG 82  Pseudomonas aeruginos...
Q8PCW9   3 RQNAYSRDQLLASARGELFGPNSGRLPNDPMLMFDRITEINDNGGSHGKGLIRAELDIRPDLWFFNCHFIGDPVMPGCLG 82  Xanthomonas campestri...
O33877   3 KQHAFTREDLLRCSRGELFGPGNAQLPAPNMLMIDRIVHISDVGGKYGKGELVAELDINPDLWFFACHFEGDPVMPGCLG 82  Pseudomonas aeruginos...
P18391   4 KRESYTKEDLLASGRGELFGAKGPQLPAPNMLMMDRVVKMTETGGNFDKGYVEAELDINPDLWFFGCHFIGDPVMPGCLG 83  Escherichia coli
Q9A246   2 QKNAYTFEELLACGRGEMFGPGNAQLPAPPMLMFDRIVRIEAEGGKYGKGYVEAEFDIRPDLWFFDCHFIGDPVMPGCLG 81  Caulobacter crescentu...
Q8YEC2   4 QKSSYGYEELLACGRGEMFGPGNAQLPLPPMLMIHRITEISETGGAFDKGYIRAEYDVRPDDWYFPCHFQGNPIMPGCLG 83  Brucella melitensis
1MKB_A   3 KRESYTKEDLLASGRGELFGAKGPQLPAPNMLMMDRVVKMTETGGNFDKGYVEAELDINPDLWFFGCHFIGDPVMPGCLG 82  Escherichia coli
4B8U_A  83 LDAMWQLVGFYLGWQGNPGRGRALGSGEVKFFGQVLPTAKKVTYNIHIKRTINRSLVLAIADGTVSVDGREIYSAEGLRV 162 Pseudomonas aeruginos...
Q8PCW9  83 LDAMWQLTGFFLTWIGAPGRGRALGCGEVKFTGQVLPTATLVTYEIEISRVINRKLVMAQSDARMLVDGREIYAAKDLRV 162 Xanthomonas campestri...
O33877  83 LDAMWQLVGFYLGWQGNPGRGRALGSGEVKFFGQVLPTAKKVTYNIHIKRTINRSLVLAIADGTVSVDGREIYSAEGLRV 162 Pseudomonas aeruginos...
P18391  84 LDAMWQLVGFYLGWLGGEGKGRALGVGEVKFTGQVLPTAKKVTYRIHFKRIVNRRLIMGLADGEVLVDGRLIYTASDLKV 163 Escherichia coli
Q9A246  82 LDAMWQLVGFFLGWSGGPGRGRALGVGEVKFTGQVTPDIKKVVYKIDLKRVIMRKLVMGIADGVLEADGKVIYETSDLKV 161 Caulobacter crescentu...
Q8YEC2  84 LDGMWQLTGFFLGWLGEPGRGMALSTGEVKFKGMVRPHTKLLEYGIDFKRVMRGRLVLGTADGWLKADGELIYQATDLRV 163 Brucella melitensis
1MKB_A  83 LDAMWQLVGFYLGWLGGEGKGRALGVGEVKFTGQVLPTAKKVTYRIHFKRIVNRRLIMGLADGEVLVDGRLIYTASDLKV 162 Escherichia coli
4B8U_A 163 GLFTSTDSF 171 Pseudomonas aeruginosa LESB58
Q8PCW9 163 GMFTSTENF 171 Xanthomonas campestris pv. campestris str. ATCC 33913
O33877 163 GLFTSTDSF 171 Pseudomonas aeruginosa PAO1
P18391 164 GLFQDTSAF 172 Escherichia coli
Q9A246 162 GLFTPEQMA 170 Caulobacter crescentus CB15
Q8YEC2 164 GLSKEGSAQ 172 Brucella melitensis
1MKB_A 163 GLFQDTSAF 171 Escherichia coli
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap