1DE5


Conserved Protein Domain Family
rhaA

?
TIGR01748: rhaA 
Click on image for an interactive view with Cn3D
L-rhamnose isomerase
This enzyme interconverts L-rhamnose and L-rhamnulose. In some species, including E. coli, this is the first step in rhamnose catabolism. Sequential steps are catalyzed by rhamnulose kinase (rhaB), then rhamnulose-1-phosphate aldolase (rhaD) to yield glycerone phosphate and (S)-lactaldehyde. Characterization of this family is based on members in E. coli and Salmonella. [Energy metabolism, Sugars]
Statistics
?
PSSM-Id: 130809
View PSSM: TIGR01748
Aligned: 4 rows
Threshold Bit Score: 833.771
Threshold Setting Gi: 20139364
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1DE5_A  12 LEQAWELAKQRFAAVGIDVEEALRQLDRLPVSMHCWQGDDVSGFENPEGSLTGGIQATGNYPGKARNASELRADLEQAMR 91 
Q8Y3I7   7 INKRYQVAKERYQAIGVDTEKALKTLKDIKISMHCWQGDDVKGFLNPDGELTGGIMATGNYPGAAHTPKQLRQDLEKAYS 86  Listeria monocytogene...
P32170   5 LEQAWELAKQRFAAVGIDVEEALRQLDRLPVSMHCWQGDDVSGFENPEGSLTGGIQATGNYPGKARNASELRADLEQAMR 84  Escherichia coli K-12
O05264   3 IKANYDSAKQAYEKWGIDVEEALRQLEQVPISIHCWQGDDIEGFEVNKGELSGGIDVTGNYPGKAQTPEELRRDLEKALS 82  Bacillus subtilis sub...
1DE5_A  92 LIPGPKRLNLHAIYLESD-TPVSRDQIKPEHFKNWVEWAKANQLGLDFNPSCFSHPLSADGFTLSHADDSIRQFWIDHCK 170
Q8Y3I7  87 LIPGKHKLNLHAIYVDTD-EKVDLNEIEPKHFTPWVEWAKEQGLGLDFNPTFFSHPMFKDNYTLASPDKEVRDFWIEHGK 165 Listeria monocytogene...
P32170  85 LIPGPKRLNLHAIYLESD-TPVSRDQIKPEHFKNWVEWAKANQLGLDFNPSCFSHPLSADGFTLSHADDSIRQFWIDHCK 163 Escherichia coli K-12
O05264  83 LIPGKHRVNLHAIYAETNrEAVERDELKPQHFENWVKWAKNLGLGLDFNPTLFSHEKAADGLTLSHPDPDIREFWIRHCI 162 Bacillus subtilis sub...
1DE5_A 171 ASRRVSAYFGEQLGTPSVMNIWIPDGMKDITVDRLAPRQRLLAALDEVISEKLNPAHHIDAVESKLFGIGAESYTVGSNE 250
Q8Y3I7 166 RSRKISEYFGKELGQTSINNFWVPDGIKDCPIDRYTPRKRLMEALDEVFAEKLDEKYTQEAVESKLFGLGAEAYTVGSHE 245 Listeria monocytogene...
P32170 164 ASRRVSAYFGEQLGTPSVMNIWIPDGMKDITVDRLAPRQRLLAALDEVISEKLNPAHHIDAVESKLFGIGAESYTVGSNE 243 Escherichia coli K-12
O05264 163 ACRRIGEYFGKELGTPCLTNIWIPDGYKDIPSDRLTPRKRLKESLDRIFSEEISEQHNLDSIESKLFGLGSESYVVGSHE 242 Bacillus subtilis sub...
1DE5_A 251 FYMGYATSRQTALCLDAGHFHPTEVISDKISAAMLYVPQLLLHVSRPVRWDSDHVVLLDDETQAIASEIVRHDLFDRVHI 330
Q8Y3I7 246 FYMGYGITRDKLICLDAGHFHPTEVISNKLSSLALFSKGVMLHVSRPVRWDSDHVVIMDDELIEIGRELVRNDLLGITNI 325 Listeria monocytogene...
P32170 244 FYMGYATSRQTALCLDAGHFHPTEVISDKISAAMLYVPQLLLHVSRPVRWDSDHVVLLDDETQAIASEIVRHDLFDRVHI 323 Escherichia coli K-12
O05264 243 FYLAYALTNHKLCLLDTGHFHPTETVSNKISSMLLYTDKLALHVSRPVRWDSDHVVVLDDELREIALEIVRNHALEKVAI 322 Bacillus subtilis sub...
1DE5_A 331 GLDFFDASINRIAAWVIGTRNMKKALLRALLEPTAELRKLEAPGDYTARLALLEEQKSLPWQAVWEMYCQRHDTPAGSEW 410
Q8Y3I7 326 GLDFFDATINRIAAWVVGTRNTQKSLLKALLEPTADLKKMELENDFTSRMAITEELKDFPFGDVWNYFCEINGVPVGLDW 405 Listeria monocytogene...
P32170 324 GLDFFDASINRIAAWVIGTRNMKKALLRALLEPTAELRKLEAAGDYTARLALLEEQKSLPWQAVWEMYCQRHDTPAGSEW 403 Escherichia coli K-12
O05264 323 GLDFFDASINRVAAWTIGTRNMIKALLYALLLPNGYLKQLQEEGRYTERLALMEEFKTYPFGAIWDSYCEQMGVPVKEAW 402 Bacillus subtilis sub...
1DE5_A 411 LESVRAYEKEILSRR 425
Q8Y3I7 406 LKEVKAYEEDVLLKR 420 Listeria monocytogenes EGD-e
P32170 404 LESVRAYEKEILSRR 418 Escherichia coli K-12
O05264 403 LYDIKEYEQQVLLKR 417 Bacillus subtilis subsp. subtilis str. 168
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap