4D9M


Conserved Protein Domain Family
diampropi_NH3ly

?
TIGR01747: diampropi_NH3ly 
Click on image for an interactive view with Cn3D
diaminopropionate ammonia-lyase family
This small subfamily includes diaminopropionate ammonia-lyase from Salmonella typhimurium and a small number of close homologs, about 50 % identical in sequence. The enzyme is a pyridoxal phosphate-binding homodimer homologous to threonine dehydratase (threonine deaminase). [Energy metabolism, Other]
Statistics
?
PSSM-Id: 130808
View PSSM: TIGR01747
Aligned: 4 rows
Threshold Bit Score: 692.019
Threshold Setting Gi: 385252036
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4D9M_A        23 LFSQSQAKLARQFHQKIAGYRPTPLCALDDLANLFGVKKILVKDESKRFGLNAFKMLGGAYAIAQLLCEKYHLDIETLSF 102 Escherichia col...
Q46804        23 LFSQSQAKLARQFHQKIAGYRPTPLCALDDLANLFGVKKILVKDESKRFGLNAFKMLGGAYAIAQLLCEKYHLDIETLSF 102 Escherichia coli
WP_002387140  21 LMSKEKIEKALAFHKSFPQYSETPLAELNHMAAYLGLNDFFVKDESYRFGLNAFKVLGGSFAMANYIAEKLKKDVSELTY 100 Enterococcus fa...
P40817        24 LLNGNVGHEVLAFHKKLPNYAVTPLHNLAHLSQRLGLGSIHIKDESWRFGLNAFKGLGGSYAVGKYLADKLQCDINSLSF 103 Salmonella ente...
4D9M_A       103 EHLKN-AIGEKM---TFATTTDGNHGRGVAWAAQQLGQNAVIYMPKGSAQERVDAILNLGAECIVTDMNYDDTVRLTMQH 178 Escherichia col...
Q46804       103 EHLKN-AIGEKM---TFATTTDGNHGRGVAWAAQQLGQNAVIYMPKGSAQERVDAILNLGAECIVTDMNYDDTVRLTMQH 178 Escherichia coli
WP_002387140 101 DELTSdQLRSAFgqaTFFTATDGNHGRGVAWAANKLGQKSVVLMPKGSTQTRKENIEKEGATVTIEEVNYDECVRMANKM 180 Enterococcus fa...
P40817       104 AALNTpEIKEKIkdcVFVTATDGNHGRGVAWAAEQLGLKAVVYMPKGSSLIRAENIRHHGAECTITDLNYDDAVRLAHRM 183 Salmonella ente...
4D9M_A       179 AQQHG-WEVVQDTAWEGYTKIPTWIMQGYATLADEAVEQMREMG-VTPTHVLLQAGVGAMAGGVLGYLVDVYSPQNLHSI 256 Escherichia col...
Q46804       179 AQQHG-WEVVQDTAWEGYTKIPTWIMQGYATLADEAVEQMREMG-VTPTHVLLQAGVGAMAGGVLGYLVDVYSPQNLHSI 256 Escherichia coli
WP_002387140 181 AEETEnGVMVQDTAWDGYEKIPTWIMQGYGTMALEASQQLRKFGsERPSHVFVQAGVGSLAGAVIGYFANAFPENPPIMV 260 Enterococcus fa...
P40817       184 AQTKG-WVLLQDTAWTGYEEIPTWIMQGYMTLAVEAYEQLAETNsPLPTHLILQAGVGSFAGSVMGYFVEKMQENIPNII 262 Salmonella ente...
4D9M_A       257 IVEPDKADCIYRSGVK--GDIVNVGGDMATIMAGLACGEPNPLGWEILRNCATQFISCQDSVAALGMRVLGNPYGN-DPR 333 Escherichia col...
Q46804       257 IVEPDKADCIYRSGVK--GDIVNVGGDMATIMAGLACGEPNPLGWEILRNCATQFISCQDSVAALGMRVLGNPYGN-DPR 333 Escherichia coli
WP_002387140 261 VVEAQAADCLYQSAIKkdGEIRFVDGDLQTIMAGLACGEPNTISFDILKNHTSFFVSAPDWVSEKGMRMLGAPLKG-DPQ 339 Enterococcus fa...
P40817       263 VVEPHQANCLYQSAVMddGQPHCVTGDMATIMAGLACGEPNIISWPIIRDNTSCFISADDCLAAKGMRISAAPRPGtDTP 342 Salmonella ente...
4D9M_A       334 IISGESGAVGLGVLAAVHYHPQRQSLMEKLALNKDAVVLVISTEGDTDVKHYREVVWE 391 Escherichia coli K-12
Q46804       334 IISGESGAVGLGVLAAVHYHPQRQSLMEKLALNKDAVVLVISTEGDTDVKHYREVVWE 391 Escherichia coli
WP_002387140 340 VVSGESGAVAMGLVATVMQDPDYQELHEALQLDETSNVLMFSTEGDTDPDNYKKILWR 397 Enterococcus faecalis
P40817       343 FISGESGAIGVGLLYELMNNMHYQDLANRLQLDASAHVLLISTEGDTSPDIYEDIVWN 400 Salmonella enterica subsp. enterica s...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap