1BRM


Conserved Protein Domain Family
asd_gamma

?
TIGR01745: asd_gamma 
Click on image for an interactive view with Cn3D
aspartate-semialdehyde dehydrogenase, gamma-proteobacterial
[Amino acid biosynthesis, Aspartate family]
Statistics
?
PSSM-Id: 130806
View PSSM: TIGR01745
Aligned: 4 rows
Threshold Bit Score: 725.928
Threshold Setting Gi: 499311148
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1BRM_A         2 KNVGFIGWRGMVGSVLMQRMVEERDFDAIRPVFFSTSQLGQAAPSFGGTTG-TLQDAFDLEALKALDIIVTCQGGDYTNE 80  Shigella flexneri
P00353         2 KNVGFIGWRGMVGSVLMQRMVEERDFDAIRPVFFSTSQLGQAAPSFGGTTG-TLQDAFDLEALKALDIIVTCQGGDYTNE 80  Escherichia coli
WP_011001923   1 MKVGLVGWRGMVGSVLMQRMQEEKDFDLIDTVFFSTSNAGGKAPSFAKTDA-PLADANDIDALKQCDTIITCQGGDYTTE 79  Ralstonia solan...
P57523         3 KIVGLVGWRGMVGSVLLKRMQEENDFSRIKPVFFSTSQFGQDGPIINNISYnILENAYNIDVLKEMDIIITCQGGSYTKE 82  Buchnera aphidi...
1BRM_A        81 IYPKLRESGWQGYWIDAASSLRMKDDAIIILDPVNQDVITDGLNNGIRTFVGGNCTVSLMLMSLGGLFANDLVDWVSVAT 160 Shigella flexneri
P00353        81 IYPKLRESGWQGYWIDAASSLRMKDDAIIILDPVNQDVITDGLNNGIRTFVGGNCTVSLMLMSLGGLFANDLVDWVSVAT 160 Escherichia coli
WP_011001923  80 IFPKLRAAGWNGYWIDAASTLRMEDDAVIVLDPVNLQLIKDAVARGTKNFIGGNCTNSILLMGVGGLFRDGLVEWVSSMT 159 Ralstonia solan...
P57523        83 IYPTLRKNGWKGYWIDAASNLRMKNDSVIILDPVNYNVIEDSINKGIRTFVGGNCTISLMLMSLGGLFQTELVEWIAVST 162 Buchnera aphidi...
1BRM_A       161 YQAASGGGARHMRELLTQMGHLYGHVADELATPSSAILDIERKVTTLTRSGELPVDNFGVPLAGSLIPWIDKQLDNGQSR 240 Shigella flexneri
P00353       161 YQAASGGGARHMRELLTQMGHLYGHVADELATPSSAILDIERKVTTLTRSGELPVDNFGVPLAGSLIPWIDKQLDNGQSR 240 Escherichia coli
WP_011001923 160 YQAASGGGANHMRELLKGMGVIHREVEEELASPASAILEIDRKVAKTIR-EDVPTEYFPAPLAGGLIPWIDKQLDNGQSK 238 Ralstonia solan...
P57523       163 YQAASGAGARHMIELLNQMGILYKSVETDLLKGSHSILSIEDKVTKISRSVNFPVKNFSVPLAASLIPWIDTEMSNGQSR 242 Buchnera aphidi...
1BRM_A       241 EEWKGQAETNKILNTSSVIPVDGLCVRVGALRCHSQAFTIKLKKDVSIPTVEELLAAHNPWAKVVPNDREITMRELTPAA 320 Shigella flexneri
P00353       241 EEWKGQAETNKILNTSSVIPVDGLCVRVGALRCHSQAFTIKLKKDVSIPTVEELLAAHNPWAKVVPNDREITMRELTPAA 320 Escherichia coli
WP_011001923 239 EEWKGQAEVNKILGTARTIPVDGLCVRIGAMRCHSLGLTLKLKRDLPLEEIESIIRSGNPWVKWVPNERGITEQELTPAA 318 Ralstonia solan...
P57523       243 EEWKGQAETNKILGTKDTILIDGTCVRIGSLRCHSQSFVIKLKKDVSLEDIEEIIRNHNKWVDVIPNSIQDTLLKLTPSS 322 Buchnera aphidi...
1BRM_A       321 VTGTLTTPVGRLRKLNMGPEFLSAFTVGDQLLWGAAEPLRRMLRQLA 367 Shigella flexneri
P00353       321 VTGTLTTPVGRLRKLNMGPEFLSAFTVGDQLLWGAAEPLRRMLRQLA 367 Escherichia coli
WP_011001923 319 ITGGLDIGVGRVRKLNMGPEYVSAFVIGDQLLWGAAEPLRRMLRILL 365 Ralstonia solanacearum
P57523       323 VTGTLNIPIGRLRKLNMGKKYLSAFTVGDQLLWGAAEPLRRMLNILI 369 Buchnera aphidicola str. APS (Acyrthosiphon pisum)
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap