2FXV


Conserved Protein Domain Family
XPRTase

?
TIGR01744: XPRTase 
Click on image for an interactive view with Cn3D
xanthine phosphoribosyltransferase
This model represent a xanthine-specific phosphoribosyltransferase of Bacillus subtilis and closely related proteins from other species, mostly from other Gram-positive bacteria. The adjacent gene is a xanthine transporter; B. subtilis can import xanthine for the purine salvage pathway or for catabolism to obtain nitrogen. [Purines, pyrimidines, nucleosides, and nucleotides, Salvage of nucleosides and nucleotides]
Statistics
?
PSSM-Id: 130805
View PSSM: TIGR01744
Aligned: 5 rows
Threshold Bit Score: 325.991
Threshold Setting Gi: 110591504
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2FXV_A         1 MEALKRKIEEEGVVLSDQVLKVDSFLNHQIDPLLMQRIGDEFASRFAKDGITKIVTIESSGIAPAVMTGLKLGVPVVFAR 80  Bacillus subtilis
WP_004584630   1 MELLKQRILQDGKCYPGGILKVDSFINHQMDSKLMYHVAEEFARLFADSGVNKIVTIEASGIAPAIMVGYIMNLPVVFVK 80  Porphyromonas g...
WP_000421410   1 MELLGQKVKEDGVVIDEKILKVDGFLNHQIDAKLMNEVGRTFYEQFKDKGITKILTIEASGIAPAIMAALHFDVPCLFAK 80  Staphylococcus ...
WP_010888255   1 MQSLVEAIKREGRVLPGGFLKVDGLVNHQLHPALTREMGETFARHFAPLAPTKVLTIEVSGIAPAIMTAAELGVPMVYAR 80  Deinococcus rad...
P42085         1 MEALKRKIEEEGVVLSDQVLKVDSFLNHQIDPLLMQRIGDEFASRFAKDGITKIVTIESSGIAPAVMTGLKLGVPVVFAR 80  Bacillus subtil...
2FXV_A        81 KHKSLTLtDNLLTASVYSFTKQTESQIAVSGTHLSDQDHVLIIDDFLANGQAAHGLVSIVKQAGASIAGIGIVIEKSFQP 160 Bacillus subtilis
WP_004584630  81 KKQPKTM-DNMLTTTVHSFTKSRDYTVCISHDFLTDDDRILFIDDFLAYGNAAQGIIDLAEQASAKIVGMGFIIEKAFQN 159 Porphyromonas g...
WP_000421410  81 KAKPSTLtDGYYETSIHSFTKNKTSTVIVSKEFLSEEDTVLIIDDFLANGDASLGLYDIAQQANAKTAGIGIVVEKSFQN 160 Staphylococcus ...
WP_010888255  81 KKKPLTMsEQVYTAQSVSRTKGGTVDLFVSSEYLGPQDRVVVIDDFLASGGTLRSLSQIIADSGATLLGLGCVIEKEFEG 160 Deinococcus rad...
P42085        81 KHKSLTLtDNLLTASVYSFTKQTESQIAVSGTHLSDQDHVLIIDDFLANGQAAHGLVSIVKQAGASIAGIGIVIEKSFQP 160 Bacillus subtil...
2FXV_A       161 GRDELVKLGYRVESLARIQSLEEGKVSFVQE 191 Bacillus subtilis
WP_004584630 160 GREALQERGIRVESLAIIRSLDNCCITIADE 190 Porphyromonas gingivalis
WP_000421410 161 GHQRLEEAGLTVSSLCKVASLEGNKVTLVGE 191 Staphylococcus aureus
WP_010888255 161 GRQHLADLNVPIHTLANIVRMSEEEGIVVQA 191 Deinococcus radiodurans
P42085       161 GRDELVKLGYRVESLARIQSLEEGKVSFVQE 191 Bacillus subtilis subsp. subtilis str. 168
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap