1P4A


Conserved Protein Domain Family
purR_Bsub

?
TIGR01743: purR_Bsub 
Click on image for an interactive view with Cn3D
pur operon repressor, Bacillus subtilis type
This model represents the puring operon repressor PurR of low-GC Gram-positive bacteria. This homodimeric repressor contains a large region homologous to phosphoribosyltransferases and is inhibited by 5-phosphoribosyl 1-pyrophosphate. [Purines, pyrimidines, nucleosides, and nucleotides, Purine ribonucleotide biosynthesis, Regulatory functions, DNA interactions]
Statistics
?
PSSM-Id: 130804
View PSSM: TIGR01743
Aligned: 5 rows
Threshold Bit Score: 435.752
Threshold Setting Gi: 499320435
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1P4A_A         3 FRRSGRLVDLTNYLLTHPHELIPLTFFSERYESAKSSISEDLTIIKQTFEQQGIGTLLTVPGAAGGVKYIPKMKQAEAEE 82  Bacillus subtil...
P37551         3 FRRSGRLVDLTNYLLTHPHELIPLTFFSERYESAKSSISEDLTIIKQTFEQQGIGTLLTVPGAAGGVKYIPKMKQAEAEE 82  Bacillus subtil...
AAM25698       5 YKRYERLVALLKFFTDNPNKLVNLEQFMDMFNIAKSSASEDIDILEEILEKFDMGKLMTFPGAGGGVKYIPVSSLKSYVP 84  Caldanaerobacte...
WP_011010927   4 LSRNSRVSIITKVLIENPNKIIGLNKFSDLLNAAKSTISEDIVIVREVLSKFSMGKVETIAGAAGGIRYIPEVGEVEKRK 83  Clostridium per...
Q97NP1         3 LRRSDRMVVISNYLINNPYKLTSLNTFAEKYESAKSSISEDIVIIKRAFEEIEIGHIQTVTGAGGGVIFTPSISSQDAKE 82  Streptococcus p...
1P4A_A        83 FVQTLGQSLANPERILPGGYVYLTDILGKPSVLSKVGKLFASVFAEREIDVVMTVATKGIPLAYAAASYLNVPVVIVRKD 162 Bacillus subtil...
P37551        83 FVQTLGQSLANPERILPGGYVYLTDILGKPSVLSKVGKLFASVFAEREIDVVMTVATKGIPLAYAAASYLNVPVVIVRKD 162 Bacillus subtil...
AAM25698      85 FVKEVCERLKDPSRIIPGGFLYTADLIYSPPIVSKIAEVLVYPFIEKEIDAVVTVETKGIPIALMCARVLNVPLVIVRKD 164 Caldanaerobacte...
WP_011010927  84 FLEELCDIASESNRVVPGNFLYVTDIMFNPSIISKASIILASYFQDMDIDYVITVETKGVPLAYEVAKCLGVQLITARRD 163 Clostridium per...
Q97NP1        83 MVEDLRTKLSESDRILPGGYIYLSDLLSTPAILKNIGRIIAKSFMDQKIDAVMTVATKGVPLANAVANVLNVSFVIVRRD 162 Streptococcus p...
1P4A_A       163 NKVTEGSTVSINYVSGSS-NRIQTMSLAKRSMKTGSNVLIIDDFMKAGGTINGMINLLDEFNANVAGIGVLVEAEGVDER 241 Bacillus subtil...
P37551       163 NKVTEGSTVSINYVSGSS-NRIQTMSLAKRSMKTGSNVLIIDDFMKAGGTINGMINLLDEFNANVAGIGVLVEAEGVDER 241 Bacillus subtil...
AAM25698     165 SRVTEGSFVSINYVSGSQ-RHIRSMSLARRALDKGAKVLLVDDFMKAGGTLKGMTELMEEFDAHVVGAGVMIATEEPREK 243 Caldanaerobacte...
WP_011010927 164 SKVTEGSTVSINYVSGTS-GKIQQMCLSRKSLKQGSKCIFIDDFMRGGGTAKGLVDLLKEFDSELMGIGVLIDNKLSTNK 242 Clostridium per...
Q97NP1       163 LKITEGSTVSVNYVSGSSgDRIEKMFLSKRSLKAGSRVLIVDDFLKGGGTVNGMISLLREFDSELAGVAVFADNAQEERE 242 Streptococcus p...
1P4A_A       242 LVDEYMSLLTLSTINMKEKSIEIQNGNFL 270 Bacillus subtilis subsp. subtilis str. 168
P37551       242 LVDEYMSLLTLSTINMKEKSIEIQNGNFL 270 Bacillus subtilis subsp. subtilis str. 168
AAM25698     244 LIDNYISIFVLKNVEEEKNIVEIEISDWI 272 Caldanaerobacter subterraneus subsp. tengcongensis MB4
WP_011010927 243 ITKDYVSLIDIVEINEDG-VKMVPSM--- 267 Clostridium perfringens
Q97NP1       243 KQFDYKSLLKVTNIDVKNQAIDVEVGNIF 271 Streptococcus pneumoniae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap