Conserved Protein Domain Family
staph_tand_hypo

?
TIGR01741: staph_tand_hypo 
conserved hypothetical protein
This model represents a tandem array of 10 proteins in Staphylococcus aureus and the C-terminal region of one protein each in Bacillus subtilis and Bacillus halodurans.
Statistics
?
PSSM-Id: 130802
View PSSM: TIGR01741
Aligned: 3 rows
Threshold Bit Score: 233.248
Threshold Setting Gi: 558555797
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAB66478     213 RMETRKMQDLYQLIGEKLNDIIPGEWTKIYLYAEVLDDSTMVLFHFRTPENNQIIYSQDIPSHYNVSKDIFKTLLRELRE 292 Bacillus subtilis
ENK93908      14 MTFEEKLSQMYNEIANEISGMIPVEWEKVYTIAYVDDEGGEVVFNYTKPGSEDLNYYSDIPKDCNVSKDIFKNSWFKVYR 93  Staphylococcus ...
WP_023487122  26 MTFEEKLSEMYSEIANKIISMIPVEWEKVYAMAYIDEECGEVFYNYTEPSSDELFYYTSVIKKYNLLKSSFMDSVYELHD 105 Staphylococcus ...
AAB66478     293 LFEELRTEHRNNNDDVWTNLTLTLDRSGEFQLDYNYDDILASELDGYERIAIWEYKNLGILPEDEDDKEFVISYLGL 369 Bacillus subtilis
ENK93908      94 MFDELRETFKKEDLEPWTSCEFDFTRKGNLKVSFDYIDWIKLGFGPSGKENYYMYKKFGILPDMEYEMEEIRAVEKY 170 Staphylococcus aur...
WP_023487122 106 QFEELREVFIEEGLEPWTSCEFDFTKEDKLKVSFDYIDWINTEFDQLGRENYYMYKKFGVLPETEYEINKVKEIEQY 182 Staphylococcus aureus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap