Conserved Protein Domain Family
taurine_ABC_bnd

?
TIGR01729: taurine_ABC_bnd 
taurine ABC transporter, periplasmic binding protein
This model identifies a cluster of ABC transporter periplasmic substrate binding proteins, apparently specific for taurine. Transport systems for taurine (NH2-CH2-CH2-SO3H), sulfonates, and sulfate esters import sulfur when sulfate levels are low. The most closely related proteins outside this family are putative aliphatic sulfonate binding proteins (TIGR01728).
Statistics
?
PSSM-Id: 130790
View PSSM: TIGR01729
Aligned: 3 rows
Threshold Bit Score: 487.923
Threshold Setting Gi: 2500699
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q47537        25 VTVAYQTSAEPAKVAQADN---TFAKESGATVDWRKFDSGASIVRALASGDVQIGNLGSSPLAVAASQQVPIEVFLLASK 101 Escherichia col...
WP_003532396  50 VVVGYQQIVGPFISAIADGrfdAAAKEAGYTIDWRQFSSGGDISTALASGNVPIGVIGSTGTTAAASRGVELELFWILDN 129 Sinorhizobium m...
WP_010912495  32 ITIGYQTVVEPSKVPQADG---AYEKSTKATIDWRKFDSGADVIAAVASGSVDIGYVGSSPLAAAASRELPIQTIFVVGL 108 Mesorhizobium loti
Q47537       102 LGNSEALVVKKT--ISKPEDLIGKRIAVPFISTTHYSLLAALKH-WGIKPGQVEIVNLQPPAIIAAWQRGDIDGAYVWAP 178 Escherichia col...
WP_003532396 130 IGKSEALVAREGsgIEKPEDLKGKNVGVPFVSTSHFHLLVGLEQvWKTDPREVNILNMKPPQIVAAWQRGDIDAAYVWPP 209 Sinorhizobium m...
WP_010912495 109 IGPSEALVARNGagIEKLADLAGKKVAVPFVSTTHYSLLAALKH-ENVDAKSVQILNLRPPEIAAAFARGDIDAAYVWDP 187 Mesorhizobium loti
Q47537       179 AVNALEKDGKVLTDSEQVGQWGAPTLDVWVVRKDFAEKHPEVVKAFAKSAIDAQQPYIANPDVWLKQPENISKLARLSGV 258 Escherichia col...
WP_003532396 210 ALSELLKSGKVISDSEAIGAASVPTFDGLVADKEWAEENPKFMAAFTKVLADAYADYKANGSGWKADSPQVQGMVKLIGG 289 Sinorhizobium m...
WP_010912495 188 ALGQIKTTGKVVLDSSQVAAWGAPTFDAWIVRTDFAQKNPEAVRDFVKVTGAAYAEYLAKPDAWSVSSPQAGKIAKLTGA 267 Mesorhizobium loti
Q47537       259 PEGDVPGLVKGNTYLTPQQQ-TAELTG-PVNKAIIDTAQFLKEQGKVPAVANDYSQYVTSRFVQ 320 Escherichia coli K-12
WP_003532396 290 DAEGIVQALNLLSFPTADEQvSDKWLGgGAVRALEASAKFLVAQKQIDTALDDYAPFVNSAYAK 353 Sinorhizobium meliloti
WP_010912495 268 KLEEVPELLKGYVFPTLEEQaSDKFLGgGTVKAVAAASAFLKEQGKVDAVLPDYSKYVTSKYVT 331 Mesorhizobium loti
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap