3E4R


Conserved Protein Domain Family
SsuA_fam

?
TIGR01728: SsuA_fam 
Click on image for an interactive view with Cn3D
ABC transporter, substrate-binding protein, aliphatic sulfonates family
Members of this family are substrate-binding periplasmic proteins of ABC transporters. This subfamily includes SsuA, a member of a transporter operon needed to obtain sulfur from aliphatic sulfonates. Related proteins outside the scope of this model include taurine (NH2-CH2-CH2-S03H) binding proteins, the probable sulfate ester binding protein AtsR, and the probable aromatic sulfonate binding protein AsfC. All these families make sulfur available when Cys and sulfate levels are low. Please note that phylogenetic analysis by neighbor-joining suggests that a number of sequences belonging to this family have been excluded because of scoring lower than taurine-binding proteins. [Transport and binding proteins, Other]
Statistics
?
PSSM-Id: 130789
View PSSM: TIGR01728
Aligned: 11 rows
Threshold Bit Score: 311.218
Threshold Setting Gi: 499174337
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3E4R_A        31 LRIGYQK---AVSSLVLAKQHRLLEQRFPR--TKITWVEFPAGPQLLEALNVGSIDLGGAGDIPPLFAQAAG-ADLLYVG 104 Xanthomonas citri
P40400        33 IRIGIQQ---SLSPLLIAKEKGWFEDAFEKegIKVKWVEFQSGPPQFEGLAADKLDFSQVGNSPVIAGQAAG-IDFKEIG 108 Bacillus subtil...
WP_010897377  35 VTIGYFPn-lDHAAAIVGKEKGFFAEELGE--EKVEFTHFPNGNDFIEALSTGSIDIGYVGPGPAINYYLTG-GDVVVLG 110 Bacillus halodu...
WP_011018971  31 VRIGYQPs-dHSAALFVAMAKKMFEKEG----IKVETYEFKAGPPETQALAAGKIDVAYIGCVPAITAYSKG-VPIKIVA 104 Methanopyrus ka...
WP_010970043  41 IRIGSTAp--GHLKFILYRHKKLLEDEFSKegIKIELTTFDGGSAATVALGSGALDFTYIGNNPSLRLAATG-ADVKLIG 117 Sinorhizobium m...
WP_015463507  77 LRIGYQK---AVSSLVLAKQHRLLEQRFPR--TKITWVEFPAGPQLLEALNVGSIDLGGAGDIPPLFAQAAG-ADLLYVG 150 Xanthomonas
WP_006107710  27 VRVGYIAdywGTSITAIASEKGLWEKHG----LDADTRVFTNGPIQVQALGAGSLDFGYIGPG-ALWLPASG--KAKIVA 99  Brucella abortus
WP_003487421  39 LRMDYAY---YSPTSLVLKHFGWLEETLKAqgTQVKWVLSAGSNRALEYLGGNSIDFGSTAGLASLLARANG-NPIKAVY 114 Xanthomonas
WP_010871924  52 IVIGYSNw-aGWWPWAIAEEEGLFAKNG----VNVEMKWFDGYLESMQALAAGQLDGNSQTLNDTISFAGEAvNGEVAV- 125 Synechocystis s...
WP_031685745  29 LRLGDVK---GDRYAALRASGELDDLPY-----KLEMSAFPSGAPVLEALNAGALDIGFTGDIPFLFVYAAG-APLKAVG 99  Pseudomonas aer...
AAK78091      59 VKIAYFGn-iTHSQALLQRDDGSLQKALGSn-TKIKWEKFSAGSAEVESLLAGEVDIGYIGPGPAINAYTKSnGDIQVIA 136 Clostridium ace...
3E4R_A       105 WVP-Pt-pK-AETILVPSKSALRTVADLKGKRIAFQKGSSAHNLLLR-VLAKSG------L-SMRDITPLYLSpANARAA 173 Xanthomonas citri
P40400       109 LSQ-Dg-lK-ANGILVNQNSGIQDVKGLKGKKIAVAKGSSGFDFLYK-ALDQVG------L-SANDVTIIQLQpDEAASA 177 Bacillus subtil...
WP_010897377 111 SAAn----G-ATLIVARDGSGIDTLDDFDGKSFCTPGNGCTHNVQLE-IMLKELglesnrV-GGTVEHQSRIApSNMVAM 183 Bacillus halodu...
WP_011018971 105 GVN-Qe--GsAIVVRKDEAGKIKDIKDLKGKRVAELMKGSIQDCMLRtALKRAG------LdPDKDVDIVEMKtADAVNA 175 Methanopyrus ka...
WP_010970043 118 LSS-WnrsN-ETQIVVKPDSPIRKIEDLKGKKVAYLSGTVRHSTFAK-ALKAAG------L-SIGDVESLNLGiESSGPA 187 Sinorhizobium m...
WP_015463507 151 WVP-Pt-pK-AETILVPSKSALRTVADLKGKRIAFQKGSSAHNLLLR-VLAKSG------L-SMRDITPLYLSpANARAA 219 Xanthomonas
WP_006107710 100 INS-V-----GFSDRVIAQEGFKSMADLKGKKIGVPEGTSGDMLLRL-ALGKAG------M-KLDDVQVIKMDpSTVVSA 165 Brucella abortus
WP_003487421 115 IYS-Rp--E-WIALAVGKNSPIRQLTELKGKRIAATKGTDAYLFLLR-ALRQAG------L-SKSAVDIVHLQhPDGRTA 182 Xanthomonas
WP_010871924 126 LVN-Dn--S-AGNDKIIVTADINTVQDLKGKTVAIEEGVVDDFLLSL-ALEREG------M-SRDDVVIKPLEtGAAAAA 193 Synechocystis s...
WP_031685745 100 AWHfNp--A-TVALVVGKDSPIRSVAGLKGKRIAVNRGGWGHFLALG-ALRRAG------L-GPQDVSFSFLGpVDGRAA 168 Pseudomonas aer...
AAK78091     137 GAA-D---A-GAILVSKKGADIKSVKDLKNKRVAIPQYGNTQDLTLR-ILLYENglkdraK-GGNVEIVEAEN-SDIKTL 208 Clostridium ace...
3E4R_A       174 FAAGQVDAWAIWDPWYSALTLDGSARLLANGEGLGLTG----GFFLSSRRYATAWGPFVQQVMGTLNQADGLLERDRAGS 249 Xanthomonas citri
P40400       178 FENGSVDAWSIWEPYLSLETMKHGAKILVNGESTDLYSp---GFTLVRTKFSEEHPDEVVRFLKVFNKAVVWQKEHLDEA 254 Bacillus subtil...
WP_010897377 184 FEQGQIDAAAAPEPWGTYLVEELGAHVVAEWNDVFLGEelasVVVVTTREFLENHPEQVEAFLRAHVKSVEFAQEDVDAT 263 Bacillus halodu...
WP_011018971 176 LGAKQIDAFIEPEPGPTMAVKKGFGVRLMDTGKIWSHHq--cCVLVMRKDFIERHPNLAKKVLKVHVMATKYVQEHPDEA 253 Methanopyrus ka...
WP_010970043 188 LARGDVDAIVESTGPVQKLVEEGQARVIFDAGVSGSPEwavpHLISVNGDFARKYPQIVARLLAVDVAAARWADANPEET 267 Sinorhizobium m...
WP_015463507 220 FAAGQVDAWAIWDPWYSALTLDGSARLLANGEGLGLTG----GFFLSSRRYATAWGPFVQQVMGTLNQADGLLERDRAGS 295 Xanthomonas
WP_006107710 166 FASKQIDAAGIWYPLIGTIKEHVPGMVELAANSDFFPDktfpSAFIARNEIVAENPEAVKRMIAVIEEAEDFRTANPEQS 245 Brucella abortus
WP_003487421 183 LERGDVDAWSGLDPHLAASQIEAGSRLIYRNTAFNSR-----GFLNVSETFASAYPEQIPLVIQAYEKARTWAIAHPGEL 257 Xanthomonas
WP_010871924 194 FAAGQVDAVGAFPPFWLTALKREGSKELVTSAEFPGAi---pDLLVVTEKLIQEKPEQVQALVNTWFDIRKFMEENPEKS 270 Synechocystis s...
WP_031685745 169 LVRGSVDAWVPWEPYTSSAVLLDQARVIDNGAGIMTGy----SYALASDAAIARKKAAISDLLTRLARAQAWALRHPEAF 244 Pseudomonas aer...
AAK78091     209 LGKGSIDAALVPEPWGTRLVNEVKAKVVLNYEDIWRKGqyptAIVVARKEFVKAHPDIVEKFVKNLVEETNKVNSNRDNS 288 Clostridium ace...
3E4R_A       250 IKTLAQVSGl-PPAVVERTLAHRPPASVQPLSAQVIK---------AQQATADLFYAQRLLPKRVLVAPAVWRAPDA 316 Xanthomonas citri
P40400       255 ADLYSDIKD--LDKKVVENVLKNTEPLNEIISDDIVK---------AQQETADFQFRTKAIDKKIDVKDVVDNTFIK 320 Bacillus subtilis ...
WP_010897377 264 LETVNDALFdlTQNRLPEDVLYKAWERMAVTTDTYPD---------ALQAWADASYELKFMDEDPNLDGFVDTSLLD 331 Bacillus halodurans
WP_011018971 254 AKITAKQLK------VPEEVEKEAMRHVRYSVDLDVD---------SIKMFARFLKQLGYIKELPDWSDFIDLKLLK 315 Methanopyrus kandleri
WP_010970043 268 IAIFVKETGn-SDMAVRATYPNGKFYQDPEITDAAVR---------ALQGEEAFMADAGLLKGKVDYRTWIDRSFYE 334 Sinorhizobium meli...
WP_015463507 296 IKTLAQVSGl-PPAVVERTLAHRPPASVQPLSAQVIK---------AQQATADLFYAQRLLPKRVLVAPAVWRAPDA 362 Xanthomonas
WP_006107710 246 VDITAKFLKv-DKANLETEAKNGKSLTSEELVKLTRDgsv----ngWLSGMADMFVTFGKLKSPLDPKDYYLADYFT 317 Brucella abortus
WP_003487421 258 AALIAAEARl-S-PQVATLQLQRTDLRNPVIGPEERA---------ALQSAAPILLEEGLVRPGTDLGKVLAGLIDP 323 Xanthomonas
WP_010871924 271 DEIMAKRAGv-SQEELQLFKDGTRFLTLEENLEAFSPgdsmvhmpfAAQKMADFMTKVGFIEKAPDLTKILDAQFVK 346 Synechocystis sp. ...
WP_031685745 245 AEALAKDLNm-PREVTRRWVGEAR-ISPVVFGPEVAA---------TLQTAADFFHAEGVLPKSLEVAPAFDFSLSA 310 Pseudomonas aerugi...
AAK78091     289 EKAINRQLKeiTGKGLSKKILDSSFERIKVTNNPEKD---------AVLDMANWSFKAGFIKSKADLKDMFNLSFLN 356 Clostridium acetob...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap