Conserved Protein Domain Family
HEQRo_perm_3TM

?
TIGR01726: HEQRo_perm_3TM 
amine acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family
This model represents one of several classes of multiple membrane spanning regions found immediately N-terminal to the domain described by pfam00528, binding-protein-dependent transport systems inner membrane component. The region covered by this model generally is predicted to contain three transmembrane helices. Substrate specificities attributed to members of this family include histidine, arginine, glutamine, glutamate, and (in Agrobacterium) the opines octopine and nopaline. [Transport and binding proteins, Amino acids, peptides and amines]
Statistics
?
PSSM-Id: 130787
View PSSM: TIGR01726
Aligned: 25 rows
Threshold Bit Score: 90.2843
Threshold Setting Gi: 499327197
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
ZP_00063228  276 NDGAFLKGLWLTIELTVLAIILASIWGVILGVMGVSQNSAVRGLSTTLIYIFRGLPLMVLAFFIYIGLPgVIGTKIPAFT 355 Leuconostoc mes...
ZP_00034116   40 NLQPIAAGLATTLGTWAAGVAIGMLIGFLIAVLQLFCGRWVRGILRVYIELFRGTPFLVQLFLLYYGGP-SFGLTLEPMT 118 Burkholderia fu...
ZP_00031501   48 FVPILIQGAVMSIVITLGCLLLSTVLGLTWALLKMSRYPLVVRGVSTMINVVRGLPMIVLLFYIYFVLP-EIHIQVSALQ 126 Burkholderia fu...
CAB65560      11 FMPHFWDGLLVTLQILVLGSLVSFGLGLVWALLMRVPSRWVTWPVGVVTEFVRNTPLLVQLFFLFYVLP-EWNITFSALT 89  Streptomyces co...
KDA32167      40 NKDAFINGFIYTLEVSILALLIATIFGTIGGVMATSRFKIIRAYTRIYVELFQNVPLVIQIFFLFYALP-VLGIRLDIFT 118 Campylobacter j...
WP_006234268  11 NWTLFARGTWLTIVIAIVAIATGFLISIPIALMALSHRRPLRWISSAYVEWFRNIPFIVVLYLFFYGLP-FMGVRLPESI 89  Brucella abortus
WP_006313622  11 FSPAFFHGALLTLVITVTSLFFGMIAGLIVALLQESRIRPLQIFTLVYLWLFRGTPVLFQIIFIYNVLP-TFGVMLSAFV 89  Agrobacterium
WP_010913215  16 SLPALLRGFLNTLLLGILSIGIGIPIGLLISLVRLYAPKPLRWLAVGYTDIFRALPVLVVLILIYYALP-FLGIRLSSWA 94  Mesorhizobium loti
EOB33907       9 YLPLYQKAFFLTLHIAVWGILGSFLLGLIVSIIRHYRIPVLAQVATAYIELSRNTPLLIQLFFLYFGLP-RIGIVLSSEV 87  Streptococcus p...
WP_017266078  35 lsfLISQGVVTTLYISVISIAVATVIALVGAIAKLSKNGVIYGLATFYTSLFRGLPLLMQIYIIYLGLP-QVGYVISAVP 113 Sinorhizobium m...
ZP_00063228  356 AGLITLILNEGAYTGAFVRG 375 Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293
ZP_00034116  119 AGVLGLGLYGSAYFAEAFRS 138 Burkholderia fungorum
ZP_00031501  127 ASIIGLGFGYSTYVAEIFRA 146 Burkholderia fungorum
CAB65560      90 TGVVAIGLHYSTYTMQVYRA 109 Streptomyces coelicolor A3(2)
KDA32167     119 IGVLGVGAYHGAYVSEVVRS 138 Campylobacter jejuni K1
WP_006234268  90 VGTIALAFFASSYFAEIIRG 109 Brucella abortus
WP_006313622  90 SAVIALSLNEGAYMAEIIRS 109 Agrobacterium
WP_010913215  95 SAVTAFAFIMSAYSAEVFRS 114 Mesorhizobium loti
EOB33907      88 CATLGLVFLGGSYMAESFRS 107 Streptococcus pneumoniae 845
WP_017266078 114 AGILALSLCYGAYMTEIFRA 133 Sinorhizobium meliloti
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap