Conserved Protein Domain Family
hmd_rel

?
TIGR01724: hmd_rel 
H2-forming N(5),N(10)-methenyltetrahydromethanopterin dehydrogenase-related protein
This model represents a sister clade to the authenticated coenzyme F420-dependent N(5),N(10)-methenyltetrahydromethanopterin reductase (HMD) of TIGR01723. Two members, designated HmdII and HmdIII, are found. Members are restricted to methanogens, but the function is unknown. [Unknown function, Enzymes of unknown specificity]
Statistics
?
PSSM-Id: 130785
View PSSM: TIGR01724
Aligned: 3 rows
Threshold Bit Score: 632.723
Threshold Setting Gi: 2833553
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q58734        12 MKVSVYGAGNQNLYINKLNLPEKFGGEPPYGGSRMAIEFAEAGHDVVLAEPNKNIMSDDLWKKVEDAGVKVVSDDVEAAK 91  Methanocaldococ...
Q58125         1 MKISIYGAGNQRLYLEQLKVPEKFGGEPPYGGAGMAIEFAKAGHDVVLSEPNRDVMSDDLWKKVEDAGVKVVSDDIEAAK 80  Methanocaldococ...
WP_010876143   7 MKVTVYGAGNQKLYTDELNLPERYGGEAPYGGSRMAMEFAMAGHDVILAEPSREFLDDEQWSMVEEAGVTVTDNDKEAAS 86  Methanothermoba...
Q58734        92 HGEIHVLFTPFGKATFRIAKTIIEHVPENAVICNTCTVSPVVLYYSLEPILRTKRKDVGISSMHPAAVPGTPQHGHYVIG 171 Methanocaldococ...
Q58125        81 HGEIHVLFTPFGRITLNIANTIIEHVPENAIICNTCTIPTPVLYRSLEGILRLKRRDVGISSMHPTGVPGTPSQKYYTIA 160 Methanocaldococ...
WP_010876143  87 EAEVAVLFTPFGKGTFSIAREILPELPEGSVIANTCTVSPVVLYYVLEKELKLERTDVGVSSMHPAAVPGTPQHGHYVIG 166 Methanothermoba...
Q58734       172 GKTTDGKELATEEQIKKAVELAKSAGKEAYVVPADVSSVVADMGSLVTAVALSGVLDYYTVGRKIINAPKKMIEQQVIMT 251 Methanocaldococ...
Q58125       161 GKALEGKEYATEDQINKLVELVKSVGKIPYVTPADVVPAVADMGALVTAVALVGVLDYYRVGTQIINAPKDMIEKQILIS 240 Methanocaldococ...
WP_010876143 167 GRPTAELDMATDEQVSRCAELAESTGKKAYIVPADVTSAVADMGSLVTAVALAGVLDYYYVGTQIIKAPEEMVEKQILMT 246 Methanothermoba...
Q58734       252 LQTMASLVETSGIEGMVKALNPELLIRSASSMKLLDRQKDLDAALEILQNLDETLkaeVEKAEIKPTTLVAAQSLVKEIK 331 Methanocaldococ...
Q58125       241 LQTIASIIETSGMEGLMKVFNKDALLSSAKNMLIDERQEDLNLALKIIEEFDKST---IGEKDISQTYLVAPQALIKEAV 317 Methanocaldococ...
WP_010876143 247 LQTMASLVETSGVDGMAAAINPELLVKSARSMHLLDEQEELDAALKKISDLNDDVmkwIEGAEVNHTDLVAAQALTGELK 326 Methanothermoba...
Q58734       332 TLIGGAAAEGAIKRSARKLFE 352 Methanocaldococcus jannaschii DSM 2661
Q58125       318 SLIGKSAVEGMIRRSSNKLFK 338 Methanocaldococcus jannaschii DSM 2661
WP_010876143 327 TVIGDRAAEGTIRRCMRKMFE 347 Methanothermobacter thermautotrophicus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap