2B0J,4JJF


Conserved Protein Domain Family
hmd_TIGR

?
TIGR01723: hmd_TIGR 
Click on image for an interactive view with Cn3D
5,10-methenyltetrahydromethanopterin hydrogenase
This model represents a clade of authenticated coenzyme N(5),N(10)-methenyltetrahydromethanopterin reductases. This enzyme does not use F420. This enzyme acts in methanogenesis and as such is restricted to methanogenic archaeal species. This clade is one of two clades in pfam03201. [Energy metabolism, Methanogenesis]
Statistics
?
PSSM-Id: 130784
View PSSM: TIGR01723
Aligned: 5 rows
Threshold Bit Score: 628.494
Threshold Setting Gi: 399904
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2B0J_A   1 MKIAILGAGCYRTHAAAGITNFMRACEVAKEVGKPEIALTHSSITYGAELLHLVPdVKEVIVSDPCFAEepGLVVID--- 77  Methanocaldococcus ja...
O27211   1 MKLAILGAGCYRTHAASGITNFSRACEVAEMVGKPEIAMTHSTITMGAELKELAG-VDEVVVADPVFDN--QFTVID--- 74  Methanothermobacter t...
Q58194   1 MKIAILGAGCYRTHAAAGITNFMRACEVAKEVGKPEIALTHSSITYGAELLHLVPdVKEVIVSDPCFAEepGLVVID--- 77  Methanocaldococcus ja...
Q02394   5 NKVAILGAGCWRTHAATGITTFKRACEVADETGIKEAALTHSSVTYAVELKHLAG-VDEVVLSDPVFDAd-GFTVVDiee 82  Methanopyrus kandleri...
4JJF_A   1 MKLAILGAGCYRTHAASGITNFSRACEVAEMVGKPEIAMTHSTITMGAELKELAG-VDEVVVADPVFDN--QFTVID--- 74  Methanothermobacter m...
2B0J_A  78 --EFDPKEVMEAHLSgNPESIMPKIREVVKAKAKELPKPPKACIHLVHPE----DVGLKVTSDDREAVEGADIVITWLPK 151 Methanocaldococcus ja...
O27211  75 --DFAYEDVIEAHKE-DPEKIMPQIREKVNEVAKELPKPPEGAIHFTHPE----DLGFEITTDDREAVADADFIMTWFPK 147 Methanothermobacter t...
Q58194  78 --EFDPKEVMEAHLSgNPESIMPKIREVVKAKAKELPKPPKACIHLVHPE----DVGLKVTSDDREAVEGADIVITWLPK 151 Methanocaldococcus ja...
Q02394  83 dcDVDLDEFIKAHLEgNPEDVMPKLRDYVNDIADDVPKPPKGAIHFLSPEemedKLDIVVTTDDAEAVEDADMIISWLPK 162 Methanopyrus kandleri...
4JJF_A  75 --DFAYEDVIEAHKE-DPEKIMPQIREKVNEVAKELPKPPEGAIHFTHPE----DLGFEITTDDREAVADADFIMTWFPK 147 Methanothermobacter m...
2B0J_A 152 GNKQPDIIKKFADAIPEGAIVTHACTIPTTKFAKIFKDLG------R-EDLNITSYHPGCVPEMKGQVYIAEGYASEEAV 224 Methanocaldococcus ja...
O27211 148 GDMQPGIIDKFIDDIKPGAIVTHACTIPTTKFYKIFEEKHgdl-vtKpETLNVTSYHPGAVPEMKGQVYIAEGYASEEAI 226 Methanothermobacter t...
Q58194 152 GNKQPDIIKKFADAIPEGAIVTHACTIPTTKFAKIFKDLG------R-EDLNITSYHPGCVPEMKGQVYIAEGYASEEAV 224 Methanocaldococcus ja...
Q02394 163 GGVQPDIFKKIIDDIPEGCIVANTCTIPTRQFKEMFEDMG------R-DDLQVTSYHPATVPEHKGQVFVAEGYADEEVV 235 Methanopyrus kandleri...
4JJF_A 148 GDMQPDIINKFIDDIKPGAIVTHACTIPTTKFYKIFEQKHgdlvtkP-ETLNVTSYHPGAVPEMKGQVYIAEGYASEDAI 226 Methanothermobacter m...
2B0J_A 225 NKLYEIGKIARGKAFKMPANLIGPVCDMCSAVTATVYAGLLAYRDAVTKILGAPADFAQMMADEALTQIHNLMKEKGIAN 304 Methanocaldococcus ja...
O27211 227 NTLFELGQKARGNAYRLPAELLGPVCDMCSALTAITYAGILSYRDSVTQVLGAPAGFAQMMAKESLEQITALMEKVGIDK 306 Methanothermobacter t...
Q58194 225 NKLYEIGKIARGKAFKMPANLIGPVCDMCSAVTATVYAGLLAYRDAVTKILGAPADFAQMMADEALTQIHNLMKEKGIAN 304 Methanocaldococcus ja...
Q02394 236 EAVYELGEKARGLAFKVPGYLLGPVCDMASAVTAIVYAGLLTFRDACTDILGAPVDFTQNMAVEALQMMAKFMEEEGLDK 315 Methanopyrus kandleri...
4JJF_A 227 ETLFELGQKARGNAYRLPAELLGPVCDMCSALTAITYAGILSYRDSVTQVLGAPASFAQMMAKESLEQITALMEKVGIDK 306 Methanothermobacter m...
2B0J_A 305 MEEALDPAALLGTADSMCFGPLAE--ILPTALKVLEKHKV 342 Methanocaldococcus jannaschii DSM 2661
O27211 307 MEEHLDPGALLGTADSMNFGASAD--ILPTVFEILEKRKK 344 Methanothermobacter thermautotrophicus str. Delta H
Q58194 305 MEEALDPAALLGTADSMCFGPLAE--ILPTALKVLEKHKV 342 Methanocaldococcus jannaschii DSM 2661
Q02394 316 LEEALDPAALTNTADSMNFGPLADteILPKALEVLEKYSK 355 Methanopyrus kandleri AV19
4JJF_A 307 MEENLDPGALLGTADSMNFGASAE--ILPTVFEILEKRKK 344 Methanothermobacter marburgensis str. Marburg
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap