Conserved Protein Domain Family

TIGR01723: hmd_TIGR 
Click on image for an interactive view with Cn3D
5,10-methenyltetrahydromethanopterin hydrogenase
This model represents a clade of authenticated coenzyme N(5),N(10)-methenyltetrahydromethanopterin reductases. This enzyme does not use F420. This enzyme acts in methanogenesis and as such is restricted to methanogenic archaeal species. This clade is one of two clades in pfam03201. [Energy metabolism, Methanogenesis]
PSSM-Id: 130784
Aligned: 5 rows
Threshold Bit Score: 628.494
Threshold Setting Gi: 399904
Created: 8-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
2B0J_A 305 MEEALDPAALLGTADSMCFGPLAE--ILPTALKVLEKHKV 342 Methanocaldococcus jannaschii DSM 2661
O27211 307 MEEHLDPGALLGTADSMNFGASAD--ILPTVFEILEKRKK 344 Methanothermobacter thermautotrophicus str. Delta H
Q58194 305 MEEALDPAALLGTADSMCFGPLAE--ILPTALKVLEKHKV 342 Methanocaldococcus jannaschii DSM 2661
4JJF_A 307 MEENLDPGALLGTADSMNFGASAE--ILPTVFEILEKRKK 344 Methanothermobacter marburgensis str. Marburg
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap