Conserved Protein Domain Family
MMSDH

?
TIGR01722: MMSDH 
methylmalonic acid semialdehyde dehydrogenase
Involved in valine catabolism, methylmalonate-semialdehyde dehydrogenase catalyzes the irreversible NAD+- and CoA-dependent oxidative decarboxylation of methylmalonate semialdehyde to propionyl-CoA. Methylmalonate-semialdehyde dehydrogenase has been characterized in both prokaryotes and eukaryotes, functioning as a mammalian tetramer and a bacterial homodimer. Although similar in monomeric molecular mass and enzymatic activity, the N-terminal sequence in P.aeruginosa does not correspond with the N-terminal sequence predicted for rat liver. Sequence homology to a variety of prokaryotic and eukaryotic aldehyde dehydrogenases places MMSDH in the aldehyde dehydrogenase (NAD+) superfamily (pfam00171), making MMSDH's CoA requirement unique among known ALDHs. Methylmalonate semialdehyde dehydrogenase is closely related to betaine aldehyde dehydrogenase, 2-hydroxymuconic semialdehyde dehydrogenase, and class 1 and 2 aldehyde dehydrogenase. In Bacillus, a highly homologous protein to methylmalonic acid semialdehyde dehydrogenase, groups out from the main MMSDH clade with Listeria and Sulfolobus. This Bacillus protein has been suggested to be located in an iol operon and/or involved in myo-inositol catabolism, converting malonic semialdehyde to acetyl CoA ad CO2. The preceeding enzymes responsible for valine catabolism are present in Bacillus, Listeria, and Sulfolobus. [Energy metabolism, Amino acids and amines]
Statistics
?
PSSM-Id: 130783
View PSSM: TIGR01722
Aligned: 3 rows
Threshold Bit Score: 802.945
Threshold Setting Gi: 1041092
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAA99190   5 VNHWIGGKTAEGASGTYGPVTNPATGEVTTKVAFASVDEVDAAVAAAREAYLTWGQSSLAQRTSILFRFRALLDAHRDEI 84  Streptomyces coelic...
Q07536    42 VKLFIDGKFIESKSDKWIDIHNPATNEVIGRVPESTKAEMDAAVSSCKRTFPAWADTSILSRQQVLLRYQQLIKENLKEI 121 cattle
P28810     5 VRHLIAGAFVEGLGAQRIPVSNPLDNSTLAEIACASAEQVEQAVASARETFASWKETPVSERARVMLRYQALLKEHHDEL 84  Pseudomonas aerugin...
AAA99190  85 AELITAEHGKVHSDALGEVARGLEIVDLACGINVQLKGELSTQVATRVDVSSIRQPLGVVAGITPFNFPAMVPLWMFPIA 164 Streptomyces coelic...
Q07536   122 ARLIMLEQGKTLADAEGDVFRGLQVVEHACSVTSLMLGDTMPSITKDMDLYSYRLPLGVCAGIAPFNFPAMIPLWMFPMA 201 cattle
P28810    85 AKIVSSELGKTFEDAKGDVWRGIEVVEHACNVPSLLMGETVENVARNIDTYSITQPLGVCVGITPFNFPAMIPLWMFPLA 164 Pseudomonas aerugin...
AAA99190 165 IACGNTFVLKPSEKDPSAAVKVAELLSEAGLPDGVFNVVHGDKVAVDRLLEHPDVKAVSFVGSTPIARYIHTTASANGKR 244 Streptomyces coelic...
Q07536   202 MVCGNTFLMKPSERVPGATMLLAKLFQDSGAPDGTLNIIHGQHEAVNFICDHPDIKAISFVGSNQAGEYIFERGSRHGKR 281 cattle
P28810   165 IACGNAFILKPSEQVPLTSVRLAELFLEAGAPKGVLQVVHGGKEQVDQLLKHPQVKAVSFVGSVAVGQYVYHTGTAHNKR 244 Pseudomonas aerugin...
AAA99190 245 VQALGGAKNHMLVLPDADLDAAADAAVSAAYGSAGERCMAISAVVAVGAVgDELVEKIRERAEKIKIGPGTDPSSEMGPL 324 Streptomyces coelic...
Q07536   282 VQANMGAKNHGVVMPDANKENTLNQLVGAAFGAAGQRCMALSTAILVGEA-KKWLPELVERAKKLRVNAGDQPGADLGPL 360 cattle
P28810   245 VQSFAGAKNHMVIMPDADKAQVISNLVGASVGAAGQRCMAISVAVLVGAA-REWIPEIRDALAKVRPGPWDDSGASYGPV 323 Pseudomonas aerugin...
AAA99190 325 ITKAHRDKVASYVAGAAAEGCEVVLDGTGYTVDGHEEGHWIGISLLERVPTTAKAYQDEIFGPVLCVLRADTYEEGVALI 404 Streptomyces coelic...
Q07536   361 ITPQAKERVCNLIDSGTKEGASILLDGRSIKVKGYENGNFVGPTIISNVKPNMTCYKEEIFGPVLVVLETDTLDEAIKIV 440 cattle
P28810   324 INPQAKARIERLIGQGVEEGAQLLLDGRGYKVEGYPDGNWVGPTLFAGVRPDMAIYREEVFGPVLCLAEVDSLEQAIRLI 403 Pseudomonas aerugin...
AAA99190 405 NASPFGNGTAIFTRDGGAARRFQLEIEAGMVGVNVPIPVPVGYHSFGGWKDSLFGDHHIYGNDGTHFYTRGKVVTTRW 482 Streptomyces coelicol...
Q07536   441 NDNPYGNGTAIFTTNGATARKYSHLVDVGQVGVNVPIPVPLPMFSFTGSRASFRGDTNFYGKQGIQFYTQLKTITSQW 518 cattle
P28810   404 NESPYGNGTSIFTSSGAAARTFQHHIEVGQVGINIPIPVPLPFFSFTGWKGSFYGDLHAYGKQGVRFYTETKTVTARW 481 Pseudomonas aeruginos...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap