1YBF


Conserved Protein Domain Family
AMN-like

?
TIGR01721: AMN-like 
Click on image for an interactive view with Cn3D
AMP nucleosidase, putative
The sequences in the clade represented by this model are most closely related to the AMP nucleosidase found in TIGR01717. These sequences are found only in Chlamydia and Porphyromonas and differ sufficiently from the characterized AMP nucleosidase to put some doubt on assignment of this name.
Statistics
?
PSSM-Id: 130782
View PSSM: TIGR01721
Aligned: 3 rows
Threshold Bit Score: 448.987
Threshold Setting Gi: 58177597
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1YBF_A         4 KTKQEIVENWLPRYTQRQLIDFEPYILLTNFSHYLHVFAEHYGVPIV-GEHTSXPNASAEGVTLINFGXGSANAATIXDL 82  Bacteroides the...
WP_010229483   8 ISEGTIARDMLERYTGSTIQEFQPYLLLTNFAYYVDVFAEIYQVPVSrGSMFSAAHAPQTCTSIIDFKLGSPGAALIVDL 87  Chlamydia murid...
WP_010883529   5 TSESRIAQDMLERYSGSSVKQFCPYLLLTNFSYYIQTFAKLHGVPVFeGSMFSAAHAPHLKTSILDFKLGSPGAALTIDL 84  Chlamydia pneum...
1YBF_A        83 L-WAIHPKAVIFLGKCGGLKLENALGDYLLPIAAIRGEGTSNDYLPEEVPSLPSFSVLRAISSAIQNKGKDYWTGTVYTT 161 Bacteroides the...
WP_010229483  88 CsFLPNALAAVMLGMCGGLRSHYQVGDYFVPVASIRKDGTSDAYFPPEVPALANFVVQKTITNILEEKNLPYHIGITHTT 167 Chlamydia murid...
WP_010883529  85 CsFLPDLKAALMLGMCGGLRSHYQVGDYFVPVASIRGEGTSDAYFPPEVPALANFVVQKATTEVLEDKKANYHIGITHTT 164 Chlamydia pneum...
1YBF_A       162 NRRVWEYDEKFKDYLRSTHASGVDXETATLXTVGFANKIPXGALLLISDRPXFPEGVKTEESDQLVTDNFAEEHLXLGID 241 Bacteroides the...
WP_010229483 168 NIRFWEFNKEFRRKLYENKAQTVEMECATLFSAGYRRNLPLGALLLISDLPLRRDGIKTKQSSSEVLATYTKKHILTGIE 247 Chlamydia murid...
WP_010883529 165 NIRFWEFNKKFRKKLYETKAQSAEMECATLFAAGYRRNLPIGALLLISDLPLRKEGIKTKSSGNFIFNTYTEDHILTGQE 244 Chlamydia pneum...
1YBF_A       242 ALEIIR----E------NKS---S-IKHIRFNW 260 Bacteroides thetaiotaomicron VPI-5482
WP_010229483 248 VFASLQ----EtvgpgiKKT---KgLPHMEFGQ 273 Chlamydia muridarum
WP_010883529 245 VIENLEkvmlKraasdhKKDqqyRgLPHMEVGE 277 Chlamydia pneumoniae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap