3EUE


Conserved Protein Domain Family
euk_UDPppase

?
TIGR01719: euk_UDPppase 
Click on image for an interactive view with Cn3D
uridine phosphorylase
This model represents a clade of mainly eucaryotic uridine phosphorylases. Genes from human and mouse have been characterized. This enzyme is a member of the PHP/UDP subfamily (pfam01048) and is closely related to the bacterial uridine (TIGR01718) and inosine (TIGR00107) phosphorylase equivalogs. In addition to the eukaryotes, a gene from Mycobacterium leprae is included in this equivalog and may have resulted from lateral gene transfer. [Purines, pyrimidines, nucleosides, and nucleotides, Salvage of nucleosides and nucleotides]
Statistics
?
PSSM-Id: 130780
View PSSM: TIGR01719
Aligned: 6 rows
Threshold Bit Score: 456.144
Threshold Setting Gi: 13093720
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3EUE_A    41 NPNIAKMK-EDILYHFNLTTS----RHNFPALFGDVKFVCVGGSPSRMKAFIRCVGAELGLDCp-GRDYPNICAGTDRYA 114 human
Q16831    23 NPNIAKMK-EDILYHFNLTTS----RHNFPALFGDVKFVCVGGSPSRMKAFIRCVGAELGLDCp-GRDYPNICAGTDRYA 96  human
AAC24419 436 NKYFDIKDkRDFLYHFGFGVD----TLDIPAVFGDTKFVCTGGSPGRFKLYAEWFAKEANIPC-----SENLS-RSDRFV 505 Caenorhabditis elegans
AAF51164   2 NPHLETAR-SDYLYHLDINVAntrdTSELQNRFGDVRVICMGGTGSRMRQLALYLRDILVVSE--SGDPVDLCERGNRYA 78  Drosophila melanoga...
CAC31132  26 DGVLDGSH-EDVYYHFGIASS-----DPALDELRDVKAVILAGTRERITTFADRWSELNGGSK--VSRVIAFS-KEDRFV 96  Mycobacterium leprae
AAF46930  52 NPCLKCLQ-PDILYHLGLNTE----TTDFPKVFGDVRFVCMGGTPGRMENFAYYVMQEIGLKInaATKLRNISEAGQRFS 126 fruit fly
3EUE_A   115 MYKVGPVLSVSHGMGIPSISIMLHELIKLLYYAR------CSNVTIIRIGTSGGIGLEPGTVVITEQAVDTCFKAEFEQI 188 human
Q16831    97 MYKVGPVLSVSHGMGIPSISIMLHELIKLLYYAR------CSNVTIIRIGTSGGIGLEPGTVVITEQAVDTCFKAEFEQI 170 human
AAC24419 506 IYKTGPVCWINHGMGTPSLSIMLVESFKLMHHAG------VKNPTFIRLGTSGGVGVPPGTVVVSTEAMNAELGDTYVQI 579 Caenorhabditis elegans
AAF51164  79 MYKVGPVLCVSHGVGSSSFSVVLHELIKLLKYAR------CQDPVLLRIGTCGGLGVPPGTVVASKNAFNGLLRNEHEIA 152 Drosophila melanoga...
CAC31132  97 TRYTAGVLFASHGMGMASASIALQELMRLVFFLKrgdleaLDKVFWCRVGTSGGIGLPSGTVVVSSEGLMADLQP-YRLL 175 Mycobacterium leprae
AAF46930 127 LFKVGPVLCASHGMGCPSISILLHELIKMMYHAK------CKDPVFIRIGTSGGIGVEPGTVIISSEAIDGRLNPVHEIL 200 fruit fly
3EUE_A   189 VLGKRVIRKTDLNKKLVQELLLCSAE-LSEFTTVVGNTMCTLDFYEGQGRLDGALCSYTEKDKQAYLEAAYAAGVRNIEM 267 human
Q16831   171 VLGKRVIRKTDLNKKLVQELLLCSAE-LSEFTTVVGNTMCTLDFYEGQGRLDGALCSYTEKDKQAYLEAAYAAGVRNIEM 249 human
AAC24419 580 IAGKRIERPTQLDAALREALCEVGKE--KSIPVETGKTMCADDFYEGQMRLDGYFCDYEEEDKYAFLRKLNALGVRNIEM 657 Caenorhabditis elegans
AAF51164 153 ILGQRVVRPAQFSEDVIRDLLAFGVDaNDGFQTISANTMGTDCFYEGQGRTDGAICEYSEKDKMEFLQKCHDLGIRNIEM 232 Drosophila melanoga...
CAC31132 176 RGGDSEYWFDGCFPAGTHNAIIAANEgIDDLAMVSGRTVSGNEFFLEQFRLDGAVCFETPTTKMAWLRWLDENGVRNIEM 255 Mycobacterium leprae
AAF46930 201 VHGVSVQHASQLDESLADEIKMCHDPcKDKYEAVIGRTLCAHDFYEGQSRLDGAFCEYTPEMKKSYLETLQSQQVKNIEM 280 fruit fly
3EUE_A   268 ESSVFAAMCSACGL-QAAVVCVTLLNRLEGDQISSPRNVLSEYQQRPQRLVSYFIKKKLSK 327 human
Q16831   250 ESSVFAAMCSACGL-QAAVVCVTLLNRLEGDQISSPRNVLSEYQQRPQRLVSYFIKKKLSK 309 human
AAC24419 658 ESTCFASFTCRAGF-QSAIVCVTLLNRMDGDQVQIAKEQYIEYEERPFRLVTAYIRKQTGI 717 Caenorhabditis elegans
AAF51164 233 EASMFASVTQKVGV-KAGDVCVTLIDRLKGDQITITIDQKHEFEQRPFFVVGRYIKRLLQQ 292 Drosophila melanogaster
CAC31132 256 EGAMIAGYLNHWGFpKFAMICCTLLNRLEGDQVTATPVQLHKFSEDLGAALFNYLKVSLLN 316 Mycobacterium leprae
AAF46930 281 ESLAFAALTSRANI-RGAVVCVAILNRLNGDQIKTPHDVLSKWEKRPQELVARYIRKVLYH 340 fruit fly
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap