Conserved Protein Domain Family

TIGR01714: phage_rep_org_N 
phage replisome organizer, putative, N-terminal region
This model represents the N-terminal domain of a small family of phage proteins. The protein contains a region of low-complexity sequence that reflects DNA direct repeats able to function as an origin of phage replication. The region covered by this model is N-terminal to the low-complexity region. [Mobile and extrachromosomal element functions, Prophage functions]
PSSM-Id: 130775
Aligned: 4 rows
Threshold Bit Score: 168.438
Threshold Setting Gi: 12697193
Created: 8-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
EZH89149      86 GMIEKVN-GVIKVTNWEKHQSLDSKAKHKEKNKLRQQRYRE 125 Staphylococcus aureus subsp. aureus 21239
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap